Tested Applications
| Positive IF-P detected in | human tonsillitis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL594-66449 targets HVCN1 in IF-P applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5350 Product name: Recombinant human HVCN1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC032672 Sequence: MATWDEKAVTRRAKVAPAERMSKFLRHFTVVGDDYHAWNINYKKWENEEEEEEEEQPPPTPVSGEEGRAAAPDVAPAPGPAPRAPLDFRGMLRKLFSSHRFQV Predict reactive species |
| Full Name | hydrogen voltage-gated channel 1 |
| Calculated Molecular Weight | 273 aa, 32 kDa |
| Observed Molecular Weight | 28-35 kDa, 40 kDa, 60 kDa |
| GenBank Accession Number | BC032672 |
| Gene Symbol | HVCN1 |
| Gene ID (NCBI) | 84329 |
| RRID | AB_2919994 |
| Conjugate | CoraLite®594 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 588 nm / 604 nm |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q96D96 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
HVCN1, also named as VSOP and HV1, Belongs to the hydrogen channel family. HVCN1 mediates the voltage-dependent proton permeability of excitable membranes. It forms a proton-selective channel through which protons may pass in accordance with their electrochemical gradient. Proton efflux, HVCN1 is accompanied by membrane depolarization, facilitates acute production of reactive oxygen species in phagocytosis. HVCN1, the voltage-sensitive proton channel, is present in human sperm and is an important regulator of the functional maturation of sperm. HVCN1 has four isoforms with MW 28-32 kDa or 40 kDa (modification). It has a dimer form with MW 60 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL594 HVCN1 antibody CL594-66449 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



