Histone H1.0 Polyclonal antibody, PBS Only

• 

  WB analysis of HeLa using 17510-1-AP (same clone as 17510-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 17510-1-AP (Histone H1.0 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17510-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse spleen using 17510-1-AP (same clone as 17510-1-PBS)

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 17510-1-AP (Histone H1.0 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17510-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat spleen using 17510-1-AP (same clone as 17510-1-PBS)

  rat spleen tissue were subjected to SDS PAGE followed by western blot with 17510-1-AP (Histone H1.0 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17510-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 17510-1-AP (same clone as 17510-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 17510-1-AP (H1F0 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17510-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A431 using 17510-1-AP (same clone as 17510-1-PBS)

  A431 cells were subjected to SDS PAGE followed by western blot with 17510-1-AP (H1F0 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17510-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 17510-1-AP (same clone as 17510-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 17510-1-AP (H1F0 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17510-1-PBS in a different storage buffer formulation.

• 

  IP experiment of A431 using 17510-1-AP (same clone as 17510-1-PBS)

  IP result of anti-Histone H1.0 (IP:17510-1-AP, 4ug; Detection:17510-1-AP 1:500) with A431 cells lysate 2400ug. This data was developed using the same antibody clone with 17510-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin cancer using 17510-1-AP (same clone as 17510-1-PBS)

  Immunohistochemical analysis of paraffin-embedded skin cancer slide using 17510-1-AP (Histone H1.0 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17510-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 17510-1-AP (same clone as 17510-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human normal colon slide using 17510-1-AP (Histone H1.0 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17510-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse liver using 17510-1-AP (same clone as 17510-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse liver tissue using Histone H1.0 antibody (17510-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17510-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 17510-1-AP (same clone as 17510-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using Histone H1.0 antibody (17510-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 17510-1-PBS in a different storage buffer formulation.

• 

  ChIP experiment of HeLa using 17510-1-AP (same clone as 17510-1-PBS)

  Chromatin was prepared from HeLa cells, cells were fixed with formaldehyde for 10 minutes. The ChIP was performed with 15 µg of cross-linked chromatin, 5 µg of Histone H1.0 Antibody (17510-1-AP) or 5 ug of Normal Rabbit IgG (30000-0-AP), and 30 µl of Protein A Magarose Beads. The immunoprecipitated DNA was quantified by real time PCR. Primers are located in the first kb of the transcribed region. This data was developed using the same antibody clone with 17510-1-PBS in a different storage buffer formulation.

Histone H1.0 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, IP, ChIP, Indirect ELISA

Cat No. 17510-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, IP, ChIP, Indirect ELISA

Synonyms

H1F0, Histone H1, H1FV, H1-0, H10

---

Product Information

17510-1-PBS targets Histone H1.0 in WB, IHC, IF/ICC, IF-P, IP, ChIP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9982

  Product name: Recombinant human Histone H1.0 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-194 aa of BC000145

  Sequence: MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK

• Full Name: H1 histone family, member 0
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC000145
• Gene Symbol: Histone H1.0
• Gene ID (NCBI): 3005
• RRID: AB_10695628
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P07305
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures.Linker histones are involved in the formation of higher order structure in chromatin and the maintenance of overall chromatin compaction. The H1F0 histones are found in cells that are in terminal stages of differentiation or that have low rates of cell division.Histone H1.0 (H1F0,H1FV) is a linker histone that is widely expressed in many tissues and almost all vertebrates, unlike some other linker histones. The observed molecular weight of H1F0 is about 32 kDa.