Product Information
67014-1-PBS targets ICAM4 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag27628 Product name: Recombinant human ICAM4 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 23-152 aa of BC029364 Sequence: ALGRRTKRAQSPKGSPLAPSGTSVPFWVRMSPEFVAVQPGKSVQLNCSNSCPQPQNSSLRTPLRQGKTLRGPGWVSYQLLDVRAWSSLAHCLVTCAGKTRWATSRITAYKPPHSVILEPPVLKGRKYTLR Predict reactive species |
Full Name | intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) |
Calculated Molecular Weight | 271 aa, 29 kDa |
Observed Molecular Weight | 42 kDa |
GenBank Accession Number | BC029364 |
Gene Symbol | ICAM4 |
Gene ID (NCBI) | 3386 |
RRID | AB_2882330 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q14773 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
This gene encodes the Landsteiner-Wiener (LW) blood group antigen(s) that belongs to the immunoglobulin (Ig) superfamily, and that shares similarity with the intercellular adhesion molecule (ICAM) protein family. The protein migrate as a 42 kDa glycoprotein on SDS PAGE. Alternative splicing results in multiple transcript variants encoding distinct isoforms.