Filter: AllWBIHCIF-P

WB analysis using 67014-1-Ig (same clone as 67014-1-PBS)
Different amount of human blood lysates were subjected to SDS PAGE followed by western blot with 67014-1-Ig (ICAM4 antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67014-1-PBS in a different storage buffer formulation.
WB analysis of human red blood cells using 67014-1-Ig (same clone as 67014-1-PBS)
human red blood cells were subjected to SDS PAGE followed by western blot with 67014-1-Ig (ICAM4 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67014-1-PBS in a different storage buffer formulation.
IHC staining of human spleen using 67014-1-Ig (same clone as 67014-1-PBS)
Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 67014-1-Ig (ICAM4 antibody) at dilution of 1:5000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67014-1-PBS in a different storage buffer formulation.
IHC staining of human spleen using 67014-1-Ig (same clone as 67014-1-PBS)
Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 67014-1-Ig (ICAM4 antibody) at dilution of 1:5000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67014-1-PBS in a different storage buffer formulation.
IHC staining of human placenta using 67014-1-Ig (same clone as 67014-1-PBS)
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 67014-1-Ig (ICAM4 antibody) at dilution of 1:5000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67014-1-PBS in a different storage buffer formulation.
IHC staining of human placenta using 67014-1-Ig (same clone as 67014-1-PBS)
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 67014-1-Ig (ICAM4 antibody) at dilution of 1:5000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67014-1-PBS in a different storage buffer formulation.
IHC staining of human colon using 67014-1-Ig (same clone as 67014-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 67014-1-Ig (ICAM4 antibody) at dilution of 1:2000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67014-1-PBS in a different storage buffer formulation.
IHC staining of human colon using 67014-1-Ig (same clone as 67014-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 67014-1-Ig (ICAM4 antibody) at dilution of 1:2000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67014-1-PBS in a different storage buffer formulation.
IF Staining of mouse spleen using 67014-1-Ig (same clone as 67014-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed mouse spleen tissue using ICAM4 antibody (67014-1-Ig, Clone: 3A9B9 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67014-1-PBS in a different storage buffer formulation.
IF Staining of mouse spleen using 67014-1-Ig (same clone as 67014-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed mouse spleen tissue using ICAM4 antibody (67014-1-Ig, Clone: 3A9B9 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67014-1-PBS in a different storage buffer formulation.

ICAM4 Monoclonal antibody, PBS Only

ICAM4 Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 67014-1-PBS

Clone No.3A9B9

Review Product

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

CD242, ICAM 4, ICAM-4, Landsteiner-Wiener blood group glycoprotein, LW

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

67014-1-PBS targets ICAM4 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Mouse / IgG1
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag27628 Product name: Recombinant human ICAM4 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 23-152 aa of BC029364 Sequence: ALGRRTKRAQSPKGSPLAPSGTSVPFWVRMSPEFVAVQPGKSVQLNCSNSCPQPQNSSLRTPLRQGKTLRGPGWVSYQLLDVRAWSSLAHCLVTCAGKTRWATSRITAYKPPHSVILEPPVLKGRKYTLR Predict reactive species
Full Name	intercellular adhesion molecule 4 (Landsteiner-Wiener blood group)
Calculated Molecular Weight	271 aa, 29 kDa
Observed Molecular Weight	42 kDa
GenBank Accession Number	BC029364
Gene Symbol	ICAM4
Gene ID (NCBI)	3386
RRID	AB_2882330
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	Q14773
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

This gene encodes the Landsteiner-Wiener (LW) blood group antigen(s) that belongs to the immunoglobulin (Ig) superfamily, and that shares similarity with the intercellular adhesion molecule (ICAM) protein family. The protein migrate as a 42 kDa glycoprotein on SDS PAGE. Alternative splicing results in multiple transcript variants encoding distinct isoforms.