Product Information
67014-1-PBS targets ICAM4 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27628 Product name: Recombinant human ICAM4 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 23-152 aa of BC029364 Sequence: ALGRRTKRAQSPKGSPLAPSGTSVPFWVRMSPEFVAVQPGKSVQLNCSNSCPQPQNSSLRTPLRQGKTLRGPGWVSYQLLDVRAWSSLAHCLVTCAGKTRWATSRITAYKPPHSVILEPPVLKGRKYTLR Predict reactive species |
| Full Name | intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) |
| Calculated Molecular Weight | 271 aa, 29 kDa |
| Observed Molecular Weight | 38-42 kDa |
| GenBank Accession Number | BC029364 |
| Gene Symbol | ICAM4 |
| Gene ID (NCBI) | 3386 |
| RRID | AB_2882330 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q14773 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
This gene encodes the Landsteiner-Wiener (LW) blood group antigen(s) that belongs to the immunoglobulin (Ig) superfamily, and that shares similarity with the intercellular adhesion molecule (ICAM) protein family. The protein migrate as a 42 kDa glycoprotein on SDS PAGE. Alternative splicing results in multiple transcript variants encoding distinct isoforms.





















