Tested Applications
Positive WB detected in | human blood tissue, human red blood cells |
Positive IHC detected in | human spleen tissue, human colon tissue, human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | mouse spleen tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:20000-1:100000 |
Immunohistochemistry (IHC) | IHC : 1:2500-1:10000 |
Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
67014-1-Ig targets ICAM4 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag27628 Product name: Recombinant human ICAM4 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 23-152 aa of BC029364 Sequence: ALGRRTKRAQSPKGSPLAPSGTSVPFWVRMSPEFVAVQPGKSVQLNCSNSCPQPQNSSLRTPLRQGKTLRGPGWVSYQLLDVRAWSSLAHCLVTCAGKTRWATSRITAYKPPHSVILEPPVLKGRKYTLR Predict reactive species |
Full Name | intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) |
Calculated Molecular Weight | 271 aa, 29 kDa |
Observed Molecular Weight | 42 kDa |
GenBank Accession Number | BC029364 |
Gene Symbol | ICAM4 |
Gene ID (NCBI) | 3386 |
RRID | AB_2882330 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | Q14773 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
This gene encodes the Landsteiner-Wiener (LW) blood group antigen(s) that belongs to the immunoglobulin (Ig) superfamily, and that shares similarity with the intercellular adhesion molecule (ICAM) protein family. The protein migrate as a 42 kDa glycoprotein on SDS PAGE. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ICAM4 antibody 67014-1-Ig | Download protocol |
IHC protocol for ICAM4 antibody 67014-1-Ig | Download protocol |
IF protocol for ICAM4 antibody 67014-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |