Tested Applications
| Positive WB detected in | HeLa cells, K-562 cells, MCF-7 cells |
| Positive FC (Intra) detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 5 publications below |
| IF | See 1 publications below |
| IP | See 2 publications below |
Product Information
10522-1-AP targets IFNAR2 in WB, IF, FC (Intra), IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0191 Product name: Recombinant human IFNAR2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 230-331 aa of BC002793 Sequence: LPPGQESESAESAKIGGIITVFLIALVLTSTIVTLKWIGYICLRNSLPKVLRQGLTKGWNAVAIHRCSHNALQSETPELKQSSCLSFPSSWDYKRASLCPSD Predict reactive species |
| Full Name | interferon (alpha, beta and omega) receptor 2 |
| Calculated Molecular Weight | 331 aa, 37 kDa |
| Observed Molecular Weight | 58-70 kDa |
| GenBank Accession Number | BC002793 |
| Gene Symbol | IFNAR2 |
| Gene ID (NCBI) | 3455 |
| RRID | AB_10694421 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P48551 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for IFNAR2 antibody 10522-1-AP | Download protocol |
| WB protocol for IFNAR2 antibody 10522-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
EMBO Rep Degradation of WTAP blocks antiviral responses by reducing the m 6 A levels of IRF3 and IFNAR1 mRNA | ||
J Virol African swine fever virus pH240R enhances viral replication via inhibition of the type I IFN signaling pathway | ||
J Virol Herpes simplex virus 1 UL36USP antagonizes type I IFN-mediated antiviral innate immunity. | ||
PLoS Pathog African swine fever virus pB318L, a trans-geranylgeranyl-diphosphate synthase, negatively regulates cGAS-STING and IFNAR-JAK-STAT signaling pathways | ||
J Biol Chem Protein kinase A suppresses anti-proliferative effect of interferon-α in hepatocellular carcinoma by activation of protein tyrosine phosphatase SHP2 | ||
Int J Biol Sci Ferroptosis-Resistant Adipocytes Drive Keloid Pathogenesis via GPX4-Mediated Adipocyte-Mesenchymal Transition and Iron-Cystine Metabolic Communication |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Angie (Verified Customer) (04-09-2024) | The antibody detected a band around 70 kD at dilution of 1:2000 incubated at room temperature for 2 hour followed by secondary antibody donkey-anti-rabbit (Alexa Fluor 800) at 1:20000 dilution, incubated for 1 hour at room temperature.
![]() |




