IFNAR2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• IFNAR2 Polyclonal antibody (10522-1-AP)

IFNAR2 Polyclonal Antibody for WB, FC (Intra), ELISA

Cat No. 10522-1-AP Copied!

Publications (8)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IF, FC (Intra), IP, ELISA

Synonyms

IFN alpha REC, IFN alpha/beta receptor 2, IFN R, IFN R 2, IFNABR

• 

  WB analysis using 10522-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10522-1-AP (IFNAR2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of MCF-7 using 10522-1-AP

  1x10^6 MCF-7 cells were intracellularly stained with 0.8 ug IFNAR2 Polyclonal antibody (10522-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.8 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for IFNAR2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, K-562 cells, MCF-7 cells
• Positive FC (Intra) detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10522-1-AP targets IFNAR2 in WB, IF, FC (Intra), IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0191

  Product name: Recombinant human IFNAR2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 230-331 aa of BC002793

  Sequence: LPPGQESESAESAKIGGIITVFLIALVLTSTIVTLKWIGYICLRNSLPKVLRQGLTKGWNAVAIHRCSHNALQSETPELKQSSCLSFPSSWDYKRASLCPSD

• Full Name: interferon (alpha, beta and omega) receptor 2
• Calculated Molecular Weight: 331 aa, 37 kDa
• Observed Molecular Weight: 58-70 kDa
• GenBank Accession Number: BC002793
• Gene Symbol: IFNAR2
• Gene ID (NCBI): 3455
• RRID: AB_10694421
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P48551
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The IFNAR2 Polyclonal antibody (Cat# 10522-1-AP) has 8 total citations. These appear in journals including Nature Biotechnology, Nature Communications, International Journal of Biological Sciences, EMBO Reports, PLoS Pathogens, Journal of Virology, and Journal of Biological Chemistry. The associated research fields span antiviral innate immunity, m6A RNA modification, cGAS-STING and JAK-STAT signaling, ferroptosis, viral replication (HSV-1, African swine fever virus), hepatocellular carcinoma, and bacterial immune evasion mechanisms.

Automatically generated from the 8 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Nat Biotechnol; Genome-wide mapping of RNA-protein associations through sequencing; Authors - Zhijie Qi
human	WB	Nat Commun; A bacterial YopJ-family acetyltransferase suppresses host immune response by Nε-acetylation of JAK1.; Authors - Tao-Tao Chen
		Int J Biol Sci; Ferroptosis-Resistant Adipocytes Drive Keloid Pathogenesis via GPX4-Mediated Adipocyte-Mesenchymal Transition and Iron-Cystine Metabolic Communication; Authors - Xiangguang Shi
human	WB	EMBO Rep; Degradation of WTAP blocks antiviral responses by reducing the m 6 A levels of IRF3 and IFNAR1 mRNA; Authors - Yong Ge
pig	WB	PLoS Pathog; African swine fever virus pB318L, a trans-geranylgeranyl-diphosphate synthase, negatively regulates cGAS-STING and IFNAR-JAK-STAT signaling pathways; Authors - Xiaohong Liu
human	WB	J Virol; Herpes simplex virus 1 UL36USP antagonizes type I IFN-mediated antiviral innate immunity.; Authors - Hui Yuan

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

One reviewer (Angie S.) rated this antibody 5/5 for Western Blot. Using a 1:2000 dilution on A549 and HEK293 cells, the antibody detected a clear band at ~70 kD. The protocol involved primary incubation at room temperature for 2 hours, followed by donkey-anti-rabbit Alexa Fluor 800 secondary antibody at 1:20000 for 1 hour at room temperature. Overall, the user reported reliable performance with strong signal detection under these conditions.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Angie (Verified Customer) (04-09-2024)

The antibody detected a band around 70 kD at dilution of 1:2000 incubated at room temperature for 2 hour followed by secondary antibody donkey-anti-rabbit (Alexa Fluor 800) at 1:20000 dilution, incubated for 1 hour at room temperature.

• Applications: Western Blot
• Primary Antibody Dilution: 1:2000
• Cell Tissue Type: A549, HEK293

IFNAR2 Antibody Western Blot validation (1:2000 dilution) in A549, HEK293 (Cat no:10522-1-AP)