• Featured Product
  • KD/KO Validated

IFT20 Polyclonal antibody

IFT20 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 13615-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, canine and More (1)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

hIFT20, Intraflagellar transport protein 20 homolog

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, MDCK cells, mouse testis tissue, rat testis tissue
Positive IP detected inmouse testis tissue
Positive IHC detected inmouse brain tissue, human endometrial cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inhTERT-RPE1 cells, MDCK cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13615-1-AP targets IFT20 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, canine samples.

Tested Reactivity human, mouse, rat, canine
Cited Reactivityhuman, mouse, rat, canine, zebrafish
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4521

Product name: Recombinant human IFT20 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-132 aa of BC038094

Sequence: MAKDILGEAGLHFDELNKLRVLDPEVTQQTIELKEECKDFVDKIGQFQKIVGGLIELVDQLAKEAENEKMKAIGARNLLKSIAKQREAQQQQLQALIAEKKMQLERYRVEYEALCKVEAEQNEFIDQFIFQK

Predict reactive species
Full Name intraflagellar transport 20 homolog (Chlamydomonas)
Calculated Molecular Weight 15 kDa
Observed Molecular Weight 15-18 kDa
GenBank Accession NumberBC038094
Gene Symbol IFT20
Gene ID (NCBI) 90410
RRIDAB_2280001
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8IY31
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Intraflagellar transport (IFT), mediated by molecular motors and IFT particles, is an important transport process that occurs in the cilium. IFT particles are multi-subunit complexes that are made up of complex A and complex B. IFT20 is a component of IFT complex B and involved in ciliary process assembly. It is associated with the Golgi complex and plays a role in the trafficking of ciliary membrane proteins from the Golgi complex to the cilium.

Protocols

Product Specific Protocols
IF protocol for IFT20 antibody 13615-1-APDownload protocol
IHC protocol for IFT20 antibody 13615-1-APDownload protocol
IP protocol for IFT20 antibody 13615-1-APDownload protocol
WB protocol for IFT20 antibody 13615-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Nature

Functional interaction between autophagy and ciliogenesis.

Authors - Pampliega Olatz O
humanIF

Nat Cell Biol

Early steps in primary cilium assembly require EHD1/EHD3-dependent ciliary vesicle formation.

Authors - Quanlong Lu
mouseIF

Nat Cell Biol

Early steps in primary cilium assembly require EHD1/EHD3-dependent ciliary vesicle formation.

Authors - Quanlong Lu
humanWB

Sci Adv

An EMT-primary cilium-GLIS2 signaling axis regulates mammogenesis and claudin-low breast tumorigenesis.

Authors - Molly M Wilson
humanIF

Nat Commun

Microtubule asters anchored by FSD1 control axoneme assembly and ciliogenesis.

Authors - Hai-Qing Tu
humanWB

Proc Natl Acad Sci U S A

EMT programs promote basal mammary stem cell and tumor-initiating cell stemness by inducing primary ciliogenesis and Hedgehog signaling.

Authors - Vincent J Guen
  • KO Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Lola (Verified Customer) (10-23-2025)

This antibody shows good specificity and low background. Suitable for immunofluorescence and expansion microscopy. It works with PFA and cold MeOH fixation.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:250
  • Cell Tissue Type: Primary myoblasts
IFT20 Antibody Immunofluorescence validation (1:250 dilution) in Primary myoblasts (Cat no:13615-1-AP)
FH

Charlotte (Verified Customer) (07-18-2024)

I did the standard iF protocol on the classic LIGHT2 cells used to study Hh signalling that depends on the primary cilia: PFA 4% 10 min cold methanol 5 min 1h in 1% BSA in PBST 1/150 in blocking solution, O.N. at 4°C 5*5min PBST 1/500 in blocking solution, 1h at RT° 4*5min PBST + 5min PBS I'm not convinced as the background is super dotty and quite important. Maybe the conditions must be optimized but it doesn't look promising

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1/150
  • Cell Tissue Type: LIGHT2
IFT20 Antibody Immunofluorescence validation (1/150 dilution) in LIGHT2 (Cat no:13615-1-AP)
FH

kes (Verified Customer) (01-17-2022)

I used it for WB(1:1000) and IF for cilia (1:200) and got good results.

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Human Liver cells
FH

Boyan (Verified Customer) (03-15-2019)

Excellent for IF labelling of the Golgi under PFA fixation.

  • Applications: Immunofluorescence,
  • Cell Tissue Type: MEF
Loading...
||
New chat

Able

正在加载,请稍候...