Tested Applications
| Positive WB detected in | HEK-293 cells, MDCK cells, mouse testis tissue, rat testis tissue |
| Positive IP detected in | mouse testis tissue |
| Positive IHC detected in | mouse brain tissue, rat ovary tissue, human placenta tissue, mouse ovary tissue, human ovary cancer tissue, human endometrial cancer tissue, rat brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | hTERT-RPE1 cells, MDCK cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13615-1-AP targets IFT20 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, canine samples.
| Tested Reactivity | human, mouse, rat, canine |
| Cited Reactivity | human, mouse, rat, canine, monkey, zebrafish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4521 Product name: Recombinant human IFT20 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-132 aa of BC038094 Sequence: MAKDILGEAGLHFDELNKLRVLDPEVTQQTIELKEECKDFVDKIGQFQKIVGGLIELVDQLAKEAENEKMKAIGARNLLKSIAKQREAQQQQLQALIAEKKMQLERYRVEYEALCKVEAEQNEFIDQFIFQK Predict reactive species |
| Full Name | intraflagellar transport 20 homolog (Chlamydomonas) |
| Calculated Molecular Weight | 15 kDa |
| Observed Molecular Weight | 15-18 kDa |
| GenBank Accession Number | BC038094 |
| Gene Symbol | IFT20 |
| Gene ID (NCBI) | 90410 |
| RRID | AB_2280001 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8IY31 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Intraflagellar transport (IFT), mediated by molecular motors and IFT particles, is an important transport process that occurs in the cilium. IFT particles are multi-subunit complexes that are made up of complex A and complex B. IFT20 is a component of IFT complex B and involved in ciliary process assembly. It is associated with the Golgi complex and plays a role in the trafficking of ciliary membrane proteins from the Golgi complex to the cilium.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for IFT20 antibody 13615-1-AP | Download protocol |
| IHC protocol for IFT20 antibody 13615-1-AP | Download protocol |
| IP protocol for IFT20 antibody 13615-1-AP | Download protocol |
| WB protocol for IFT20 antibody 13615-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-IFT20 antibody (Cat# 13615-1-AP) has 91 citations across journals including Nature, Nature Communications, Neuron, Cell Reports, PNAS, Development, Human Molecular Genetics, Journal of Cell Biology, and eLife. Research fields span ciliogenesis, intraflagellar transport, primary cilia biology, autophagy, cell cycle regulation, cancer biology, developmental biology, male infertility, ciliopathies, and Hedgehog signaling pathways.
| Species | Application | Title |
|---|---|---|
Nat Aging A primary cilia-autophagy axis in hippocampal neurons is essential to maintain cognitive resilience
| ||
Nat Cell Biol Early steps in primary cilium assembly require EHD1/EHD3-dependent ciliary vesicle formation. | ||
Nat Cell Biol Early steps in primary cilium assembly require EHD1/EHD3-dependent ciliary vesicle formation. | ||
Nat Commun Microtubule asters anchored by FSD1 control axoneme assembly and ciliogenesis. | ||
Nat Commun A mutation in VPS15 (PIK3R4) causes a ciliopathy and affects IFT20 release from the cis-Golgi. |
Reviews
What customers say
Overall, users report good performance for immunofluorescence and Western blot. Three out of four reviewers rated it 5 stars, highlighting strong specificity, low background, and reliable Golgi/cilia labeling under PFA and cold methanol fixation. Recommended dilutions range from 1:150 to 1:1000 depending on the application. One reviewer (3 stars) noted a dotty, somewhat high background in a cilia-focused IF protocol on LIGHT2 cells, suggesting conditions may need optimization. In summary, the antibody is generally well-received for IF and WB, with most users achieving clear results, though one case indicated potential background issues in specific cell contexts.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Lola (Verified Customer) (10-23-2025) | This antibody shows good specificity and low background. Suitable for immunofluorescence and expansion microscopy. It works with PFA and cold MeOH fixation.
 |
Charlotte (Verified Customer) (07-18-2024) | I did the standard iF protocol on the classic LIGHT2 cells used to study Hh signalling that depends on the primary cilia: PFA 4% 10 min cold methanol 5 min 1h in 1% BSA in PBST 1/150 in blocking solution, O.N. at 4°C 5*5min PBST 1/500 in blocking solution, 1h at RT° 4*5min PBST + 5min PBS I'm not convinced as the background is super dotty and quite important. Maybe the conditions must be optimized but it doesn't look promising
 |
kes (Verified Customer) (01-17-2022) | I used it for WB(1:1000) and IF for cilia (1:200) and got good results.
|
Boyan (Verified Customer) (03-15-2019) | Excellent for IF labelling of the Golgi under PFA fixation.
|
