CoraLite® Plus 488-conjugated IFT20 Polyclonal antibody

• 

  IF Staining of hTERT-RPE1 using CL488-13615

  Immunofluorescent analysis of (-20°C Methanol) fixed hTERT-RPE1 cells using CoraLite® Plus 488 IFT20 antibody (CL488-13615) at dilution of 1:200.

• Featured Product
• KD/KO Validated

IFT20 Polyclonal Antibody for IF/ICC

Cat No. CL488-13615

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, Canine

Applications

IF/ICC

Synonyms

hIFT20, IFT20

---

Tested Applications

• Positive IF/ICC detected in: hTERT-RPE1 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-13615 targets IFT20 in IF/ICC applications and shows reactivity with human, mouse, Canine samples.

• Tested Reactivity: human, mouse, Canine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4521

  Product name: Recombinant human IFT20 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-132 aa of BC038094

  Sequence: MAKDILGEAGLHFDELNKLRVLDPEVTQQTIELKEECKDFVDKIGQFQKIVGGLIELVDQLAKEAENEKMKAIGARNLLKSIAKQREAQQQQLQALIAEKKMQLERYRVEYEALCKVEAEQNEFIDQFIFQK

• Full Name: intraflagellar transport 20 homolog (Chlamydomonas)
• Calculated Molecular Weight: 15 kDa
• Observed Molecular Weight: 15-18 kDa
• GenBank Accession Number: BC038094
• Gene Symbol: IFT20
• Gene ID (NCBI): 90410
• RRID: AB_3672570
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IY31
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Intraflagellar transport (IFT), mediated by molecular motors and IFT particles, is an important transport process that occurs in the cilium. IFT particles are multi-subunit complexes that are made up of complex A and complex B. IFT20 is a component of IFT complex B and involved in ciliary process assembly. It is associated with the Golgi complex and plays a role in the trafficking of ciliary membrane proteins from the Golgi complex to the cilium.