• Featured Product
  • KD/KO Validated

IFT81 Polyclonal antibody, PBS Only

IFT81 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA
Cat No. 11744-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, canine

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Carnitine deficiency-associated protein expressed in ventricle 1, CDV 1, CDV 1R, CDV1, CDV-1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

11744-1-PBS targets IFT81 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat, canine samples.

Tested Reactivity human, mouse, rat, canine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2339

Product name: Recombinant human IFT81 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 550-676 aa of BC029349

Sequence: VRRLREECLQEESRYHYTNCMIKNLEVQLRRATDEMKAYISSDQQEKRKAIREQYTKNTAEQENLGKKLREKQKVIRESHGPNMKQAKMWRDLEQLMECKKQCFLKQQSQTSIGQVIQEGGEDRLIL

Predict reactive species
Full Name intraflagellar transport 81 homolog (Chlamydomonas)
Calculated Molecular Weight 676 aa, 80 kDa
Observed Molecular Weight 75-80 kDa
GenBank Accession NumberBC029349
Gene Symbol IFT81
Gene ID (NCBI) 28981
RRIDAB_2121966
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8WYA0
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Intraflagellar transport (IFT), mediated by molecular motors and IFT particles, is an important transport process that occurs in the cilium and has been shown to be essential for the assembly and maintenance of cilia and flagella in many organisms. IFT particles are multi-subunit complexes of proteins that functions to move non-membrane-bound particles from the cell body to the tip of cilium or flagellum, then return them to the cell body. Transport towards the ciliary tip is regulated by the IFT complex B (IFT-B), consisting of at least 15 IFT proteins, in association with kinesin motors, whereas transport from the ciliary tip back to the base is executed by a dynein motor in association with the IFT complex A (IFT-A), currently known to be composed of six IFT proteins. IFT81 is a subunit of IFT complex B.It may play a role in development of the testis and spermatogenesis. There are some isoforms of IFT81 with 73-78 kDa and 43-50 kDa.

Loading...
||
New chat Able
正在加载,请稍候...