Product Information
84782-5-PBS targets IGF1 in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with rat samples.
| Tested Reactivity | rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg1976 Product name: Recombinant Rat IGF1 protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 23-92 aa of AAA41386 Sequence: GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSA Predict reactive species |
| Full Name | insulin-like growth factor 1 |
| Calculated Molecular Weight | 14kd |
| Observed Molecular Weight | 12 kDa |
| GenBank Accession Number | AAA41386 |
| Gene Symbol | Igf1 |
| Gene ID (NCBI) | 24482 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P08025 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
IGF1, also named as IBP1, MGF, IGF-IA, and Somatomedin-C, belongs to the INS family. IGF1 is structurally and functionally related to INS but has a much higher growth-promoting activity. Altered expression or mutation of IGF-1 is associated with several human disorders, including type I diabetes and various forms of cancer. Defects in IGF1 are the cause of INS-like growth factor I deficiency (IGF1 deficiency) which is an autosomal recessive disorder characterized by growth retardation, sensorineural deafness, and mental retardation.











