IGF1 Recombinant monoclonal antibody

IGF1 Uni-rAb® Recombinant Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 84782-5-RR
Clone No.241890G6

Host / Isotype

Rabbit / IgG

Reactivity

rat

Applications

WB, IHC, FC (Intra), ELISA

241890G6, Igf-1, IGF-I, Insulin-like growth factor I, Somatomedin

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inrat plasma
Positive IHC detected inrat liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inTransfected HEK-293T cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84782-5-RR targets IGF1 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with rat samples.

Tested Reactivity rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1976

Product name: Recombinant Rat IGF1 protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-N-rFc

Tag: N-rFc

Domain: 23-92 aa of AAA41386

Sequence: GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSA

Predict reactive species
Full Name insulin-like growth factor 1
Calculated Molecular Weight14kd
Observed Molecular Weight12 kDa
GenBank Accession NumberAAA41386
Gene Symbol Igf1
Gene ID (NCBI) 24482
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP08025
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IGF1, also named as IBP1, MGF, IGF-IA, and Somatomedin-C, belongs to the INS family. IGF1 is structurally and functionally related to INS but has a much higher growth-promoting activity. Altered expression or mutation of IGF-1 is associated with several human disorders, including type I diabetes and various forms of cancer. Defects in IGF1 are the cause of INS-like growth factor I deficiency (IGF1 deficiency) which is an autosomal recessive disorder characterized by growth retardation, sensorineural deafness, and mental retardation.

Protocols

Product Specific Protocols
FC protocol for IGF1 antibody 84782-5-RRDownload protocol
IHC protocol for IGF1 antibody 84782-5-RRDownload protocol
WB protocol for IGF1 antibody 84782-5-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...