IKKA Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84372-4-RR (same clone as 84372-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84372-4-RR (IKKA antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84372-4-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 84372-4-RR (same clone as 84372-4-PBS)

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug IKKA Recombinant antibody (84372-4-RR, Clone:241579A2) and APC-Conjugated Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 84372-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84372-4-RR

  Biolayer interferometry (BLl) kinetic assays of 84372-4-RR against Human IKKA were performed. The affinity constant is 19.5 nM.

IKKA Uni-rAb^® Recombinant Antibody for WB, FC (Intra), Indirect ELISA

Cat No. 84372-4-PBS

Clone No.241579A2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, FC (Intra), Indirect ELISA

Synonyms

CHUK, IKK A, IKK alpha, IKK-1, IKK-alpha

---

Product Information

84372-4-PBS targets IKKA in WB, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag26573

  Product name: Recombinant human CHUK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 516-620 aa of NM_001278

  Sequence: MEKAIHYAEVGVIGYLEDQIMSLHAEIMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRVLKELFGHLSKLLGCKQKIID

• Full Name: conserved helix-loop-helix ubiquitous kinase
• Calculated Molecular Weight: 85 kDa
• Observed Molecular Weight: 85 kDa
• GenBank Accession Number: NM_001278
• Gene Symbol: IKK Alpha
• Gene ID (NCBI): 1147
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O15111
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.