Home
Products
Primary Antibodies
Recombinant Antibodies
IKKA Recombinant monoclonal antibody, PBS Only (84372-4-PBS)

IKKA Recombinant monoclonal antibody, PBS Only

Name: IKKA Recombinant monoclonal antibody, PBS Only, 100ug
Brand: Proteintech
SKU: 84372-4-PBS-100UG

IKKA Uni-rAb^® Recombinant Antibody for WB, FC (Intra), Indirect ELISA

Cat No. 84372-4-PBS

Clone No. 241579A2

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, FC (Intra), Indirect ELISA

Synonyms

CHUK, IKK A, IKK alpha, IKK-1, IKK-alpha

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBFC (Intra)Affinity

WB analysis using 84372-4-RR (same clone as 84372-4-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 84372-4-RR (IKKA antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84372-4-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
FC experiment of HepG2 using 84372-4-RR (same clone as 84372-4-PBS)
1x10^6 HepG2 cells were intracellularly stained with 0.25 ug IKKA Recombinant antibody (84372-4-RR, Clone:241579A2) and APC-Conjugated Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 84372-4-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
1x10^6 HepG2 cells were intracellularly stained with 0.25 ug IKKA Recombinant antibody (84372-4-RR, Clone:241579A2) and APC-Conjugated Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 84372-4-PBS in a different storage buffer formulation.
Affinity and Kinetic Characterization of 84372-4-RR
Biolayer interferometry (BLl) kinetic assays of 84372-4-RR against Human IKKA were performed. The affinity constant is 19.5 nM.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for IKKA in ?

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

84372-4-PBS targets IKKA in WB, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Ag26573 Product name: Recombinant human CHUK protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 516-620 aa of NM_001278 Sequence: MEKAIHYAEVGVIGYLEDQIMSLHAEIMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRVLKELFGHLSKLLGCKQKIID Predict reactive species
Full Name	conserved helix-loop-helix ubiquitous kinase
Calculated Molecular Weight	85 kDa
Observed Molecular Weight	85 kDa
GenBank Accession Number	NM_001278
Gene Symbol	IKK Alpha
Gene ID (NCBI)	1147
RRID	AB_3671907
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	O15111
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.