Tested Applications
| Positive WB detected in | Jurkat cells, Daudi cells, HeLa cells, HepG2 cells, RAW 264.7 cells, C6 cells |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
84372-4-RR targets IKKA in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag26573 Product name: Recombinant human CHUK protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 516-620 aa of NM_001278 Sequence: MEKAIHYAEVGVIGYLEDQIMSLHAEIMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRVLKELFGHLSKLLGCKQKIID Predict reactive species |
| Full Name | conserved helix-loop-helix ubiquitous kinase |
| Calculated Molecular Weight | 85 kDa |
| Observed Molecular Weight | 85 kDa |
| GenBank Accession Number | NM_001278 |
| Gene Symbol | IKK Alpha |
| Gene ID (NCBI) | 1147 |
| RRID | AB_3671907 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | O15111 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for IKKA antibody 84372-4-RR | Download protocol |
| WB protocol for IKKA antibody 84372-4-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
J Ethnopharmacol A new renal protective strategy: Shenfu decoction targets hypertensive renal disease through the AMPK/SIRT1/PGC-1α pathway. | ||
J Ethnopharmacol Protective effect and mechanism of synagrantol A from Euphorbia pseudomollis on LPS-induced neuroinflammation. | ||
BMC Med PROTAC-mediated PCSK9 degradation attenuates atherosclerosis and improves plaque composition via suppression of NF-κB/TNF-α pathway. | ||
J Ethnopharmacol Mechanistic Insights into the Effects of Norisoboldine on Intestinal Immunity and Neuroinflammation in a Mouse Model of Slow Transit Constipation with Depression |





