Tested Applications
| Positive FC (Intra) detected in | LPS and Brefeldin A treated mouse peritoneal macrophages |
Recommended dilution
| Application | Dilution |
|---|---|
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension |
| This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
98179-1-RR targets IL-1 beta in WB, FC (Intra) applications and shows reactivity with mouse samples.
| Tested Reactivity | mouse |
| Cited Reactivity | human, mouse, zebrafish |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg1577 Product name: Recombinant Mouse IL-1 beta protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: N-6*His Domain: 118-269 aa of NM_008361.4 Sequence: VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS Predict reactive species |
| Full Name | interleukin 1 beta |
| Calculated Molecular Weight | 31kDa |
| GenBank Accession Number | NM_008361.4 |
| Gene Symbol | IL-1 beta |
| Gene ID (NCBI) | 16176 |
| RRID | AB_3745861 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P10749 |
| Storage Buffer | PBS with 0.09% sodium azide, pH 7.3. |
| Storage Conditions | Store at 2 - 8°C. Stable for one year after shipment. |
Background Information
Interleukin-1 is a pro-inflammatory cytokine with multiple biological effects. The IL-1 gene family encodes three proteins: IL-1α, IL-1β and their naturally occurring inhibitor Il-1RN. Interleukin 1β(IL-1β), mainly produced by blood monocytes and tissue macrophages, has been implicated in mediating both acute and chronic inflammation. IL-1β is known to be involved in a variety of cellular activities, including cell proliferation, differentiation and apoptosis. IL-1β is emerging as a key mediator of carcinogenesis that characterizes host-environment interactions (PMID: 8630372; PMID: 12401481; PMID: 23704929; PMID: 24618930).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for IL-1 beta antibody 98179-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Anti-Mouse IL-1β Rabbit Recombinant Antibody (241364B3), catalog number 98179-1-RR, has 5 citations. These appear in NPJ Biofilms Microbiomes, Acta Biomaterialia, Brain, Behavior, and Immunity, Journal of Ethnopharmacology, and Nutrients. The research fields span gut microbiome and fat metabolism, diabetic foot ulcer tissue repair, Parkinson's disease neuroinflammation, diabetic nephropathy, and diabetic cardiomyopathy.
| Species | Application | Title |
|---|---|---|
NPJ Biofilms Microbiomes Gut-resident Phascolarctobacterium succinatutens decreases fat accumulation via MYC-driven epigenetic regulation of arginine biosynthesis | ||
Acta Biomater Adhesive polyethylene glycol hydrogels with metformin enabling in-situ drug delivery reprogramming immuno-metabolism for tissue repair in diabetic foot ulcers. | ||
Brain Behav Immun Platelet factor 4 prevents neuroinflammation and neurodegeneration in Parkinson's disease model via regulating protocadherin gamma/Pyk2 pathway. | ||
J Ethnopharmacol Senkyunolide a from danggui buxue decoction protects podocytes against diabetic nephropathy via the mir-223-3p/nlrp3 inflammasome axis. | ||
Nutrients High-Fat Diet-Induced Diabetic Cardiomyopathy in Female Zebrafish: Cardiac Pathology and Functional Decline Mediated by Type 2 Diabetes |
