Tested Applications
| Positive FC (Intra) detected in | LPS and Brefeldin A treated mouse peritoneal macrophages |
Recommended dilution
| Application | Dilution |
|---|---|
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension |
| This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
Product Information
98179-1-RR targets IL-1 beta in WB, FC (Intra) applications and shows reactivity with mouse samples.
| Tested Reactivity | mouse |
| Cited Reactivity | human, zebrafish |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg1577 Product name: Recombinant Mouse IL-1 beta protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: N-6*His Domain: 118-269 aa of NM_008361.4 Sequence: VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS Predict reactive species |
| Full Name | interleukin 1 beta |
| Calculated Molecular Weight | 31kDa |
| GenBank Accession Number | NM_008361.4 |
| Gene Symbol | IL-1 beta |
| Gene ID (NCBI) | 16176 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | P10749 |
| Storage Buffer | PBS with 0.09% sodium azide, pH 7.3. |
| Storage Conditions | Store at 2 - 8°C. Stable for one year after shipment. |
Background Information
Interleukin-1 is a pro-inflammatory cytokine with multiple biological effects. The IL-1 gene family encodes three proteins: IL-1α, IL-1β and their naturally occurring inhibitor Il-1RN. Interleukin 1β(IL-1β), mainly produced by blood monocytes and tissue macrophages, has been implicated in mediating both acute and chronic inflammation. IL-1β is known to be involved in a variety of cellular activities, including cell proliferation, differentiation and apoptosis. IL-1β is emerging as a key mediator of carcinogenesis that characterizes host-environment interactions (PMID: 8630372; PMID: 12401481; PMID: 23704929; PMID: 24618930).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for IL-1 beta antibody 98179-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
NPJ Biofilms Microbiomes Gut-resident Phascolarctobacterium succinatutens decreases fat accumulation via MYC-driven epigenetic regulation of arginine biosynthesis | ||
Nutrients High-Fat Diet-Induced Diabetic Cardiomyopathy in Female Zebrafish: Cardiac Pathology and Functional Decline Mediated by Type 2 Diabetes |



