PE Anti-Mouse IL-1 beta Rabbit Recombinant Antibody

IL-1 beta Uni-rAb® Recombinant Antibody for FC (Intra)
Cat No. PE-98179
Clone No.241364B3

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC (Intra)

IL 1beta, Il1b, 241364B3, IL 1 beta, Il 1b

Formulation:  PBS, Azide
PBS, Azide
Conjugate:  PE
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inLPS and Brefeldin A treated mouse peritoneal macrophages

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.1 ug per 10^6 cells in a 100 µl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

PE-98179 targets IL-1 beta in FC (Intra) applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1577

Product name: Recombinant Mouse IL-1 beta protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: N-6*His

Domain: 118-269 aa of NM_008361.4

Sequence: VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS

Predict reactive species
Full Name interleukin 1 beta
Calculated Molecular Weight31kDa
GenBank Accession NumberNM_008361.4
Gene Symbol IL-1 beta
Gene ID (NCBI) 16176
Conjugate PE Fluorescent Dye
Excitation/Emission Maxima Wavelengths496 nm, 565 nm / 578 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP10749
Storage Buffer PBS with 0.09% sodium azide, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Interleukin-1 is a pro-inflammatory cytokine with multiple biological effects. The IL-1 gene family encodes three proteins: IL-1α, IL-1β and their naturally occurring inhibitor Il-1RN. Interleukin 1β(IL-1β), mainly produced by blood monocytes and tissue macrophages, has been implicated in mediating both acute and chronic inflammation. IL-1β is known to be involved in a variety of cellular activities, including cell proliferation, differentiation and apoptosis. IL-1β is emerging as a key mediator of carcinogenesis that characterizes host-environment interactions (PMID: 8630372; PMID: 12401481; PMID: 23704929; PMID: 24618930).

Protocols

Product Specific Protocols
FC protocol for PE IL-1 beta antibody PE-98179Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...