Anti-Mouse IL-15 Rabbit Recombinant Antibody

IL-15 Uni-rAb® Recombinant Antibody for FC (Intra)
Cat No. 98036-1-RR
Clone No.230285B3

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC (Intra)

230285B3, AI503618, Il15, interleukin 15

Formulation:  PBS, Azide
PBS, Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inMouse PBMCs

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

98036-1-RR targets IL-15 in FC (Intra) applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0359

Product name: recombinant mouse il15 protein

Source: mammalian cells-derived, pHZ-KIsec-Cfc-2

Tag: C-FC

Domain: 49-162 aa of NM_001254747

Sequence: NWIDVRYDLEKIESLIQSIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILHEYSNMTLNETVRNVLYLANSTLSSNKNVAESGCKECEELEEKTFTEFLQSFIRIVQMFINTS

Predict reactive species
Full Name interleukin 15
Calculated Molecular Weight 19 kDa
GenBank Accession NumberNM_001254747
Gene Symbol IL-15
Gene ID (NCBI) 16168
RRIDAB_3672182
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP48346
Storage Buffer PBS with 0.09% sodium azide, pH 7.3.
Storage ConditionsStore at 2-8°C. Stable for one year after shipment.

Background Information

IL-15 is a 4-α-helix bundle cytokine playing a pivotal role in stimulation of both innate and adaptive immune cells. It is produced primarily by keratinocytes, skeletal muscle cells, monocytes, and CD4+ T cells. It is a member of the common gamma chain family. The members of the common gamma chain family include the IL-2, IL-4, IL-7, IL-9, and IL-21 and require binding to the common gamma chain receptor for activation. It can be used in growth and maintenance of T and NK cells. It is also shown to be used in proliferation and functional effect of T cells for adoptive cell therapy. It is a glycosylated protein and HumanKine IL-15 appear as 12.5-25 kDa bands (PMID: 24587813, 26627006, 27849617, 31250350)

Loading...
||
New chat Able
正在加载,请稍候...