CoraLite® Plus 488 Anti-Mouse IL-15 Rabbit Recombinant Antibody

IL-15 Uni-rAb® Recombinant Antibody for FC (Intra)
Cat No. CL488-98036
Clone No.230285B3

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC (Intra)

230285B3, AI503618, Il15, interleukin 15

Formulation:  PBS, Azide
PBS, Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inmouse PBMCs

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.5 ug per 10^6 cells in a 100 µl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-98036 targets IL-15 in FC (Intra) applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0359

Product name: recombinant mouse il15 protein

Source: mammalian cells-derived, pHZ-KIsec-Cfc-2

Tag: C-FC

Domain: 49-162 aa of NM_001254747

Sequence: NWIDVRYDLEKIESLIQSIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILHEYSNMTLNETVRNVLYLANSTLSSNKNVAESGCKECEELEEKTFTEFLQSFIRIVQMFINTS

Predict reactive species
Full Name interleukin 15
Calculated Molecular Weight 19 kDa
GenBank Accession NumberNM_001254747
Gene Symbol IL-15
Gene ID (NCBI) 16168
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP48346
Storage Buffer PBS with 0.09% sodium azide, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

IL-15 is a 4-α-helix bundle cytokine playing a pivotal role in stimulation of both innate and adaptive immune cells. It is produced primarily by keratinocytes, skeletal muscle cells, monocytes, and CD4+ T cells. It is a member of the common gamma chain family. The members of the common gamma chain family include the IL-2, IL-4, IL-7, IL-9, and IL-21 and require binding to the common gamma chain receptor for activation. It can be used in growth and maintenance of T and NK cells. It is also shown to be used in proliferation and functional effect of T cells for adoptive cell therapy. It is a glycosylated protein and HumanKine IL-15 appear as 12.5-25 kDa bands (PMID: 24587813, 26627006, 27849617, 31250350)

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 IL-15 antibody CL488-98036Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...