Tested Applications
Positive IF-P detected in | human tonsillitis tissue |
Recommended dilution
Application | Dilution |
---|---|
Immunofluorescence (IF)-P | IF-P : 1:300-1:1200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
CL594-60270 targets IL-28A in IF-P applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag18525 Product name: Recombinant human IL-28A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 21-91 aa of BC113583 Sequence: TVTGAVPVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCRCHSRLFPRTWDLRQLQV Predict reactive species |
Full Name | interleukin 28A (interferon, lambda 2) |
Calculated Molecular Weight | 200 aa, 22 kDa |
GenBank Accession Number | BC113583 |
Gene Symbol | IL-28A |
Gene ID (NCBI) | 282616 |
RRID | AB_2919908 |
Conjugate | CoraLite®594 Fluorescent Dye |
Excitation/Emission Maxima Wavelengths | 588 nm / 604 nm |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | Q8IZJ0 |
Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
IL28A, also named as IFNL2 and ZCYT020, is a cytokine with immunomodulatory activity. It up-regulates MHC class I antigen expression. IL28A is a ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IFNLR1. The ligand/receptor complex seems to signal through the Jak-STAT pathway. It plays a significant role in the antiviral immune defense in the intestinal epithelium.
Protocols
Product Specific Protocols | |
---|---|
IF protocol for CL594 IL-28A antibody CL594-60270 | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |