Tested Applications
| Positive FC (Intra) detected in | PMA, Ionomycin and Brefeldin A treated C57BL/6 Th2-polarized splenocytes |
Recommended dilution
| Application | Dilution |
|---|---|
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.06 ug per 10^6 cells in a 100 µl suspension |
| This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
APC-98360-2 targets IL-4 in FC (Intra) applications and shows reactivity with mouse samples.
| Tested Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg3750 Product name: Recombinant Mouse IL-4 protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 21-140 aa of BC027514 Sequence: HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS Predict reactive species |
| Full Name | interleukin 4 |
| GenBank Accession Number | BC027514 |
| Gene Symbol | IL-4 |
| Gene ID (NCBI) | 16189 |
| Conjugate | APC Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 650 nm / 660 nm |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P07750 |
| Storage Buffer | PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment. |
Background Information
Interleukin-4 (IL-4), a member of the α-helical cytokine family, is produced by activated CD4+ T cells, basophils, and mast cells. It promotes the proliferation and differentiation of antigen-presenting cells. IL-4 also plays a pivotal role in antibody isotype switching and stimulates the production of IgE. This cytokine has been applied in the treatment of autoimmune disorders like multiple myeloma, cancer, psoriasis, and arthritis. IL-4 has also been extensively applied to inhibit detrimental effect of Th1. It may promote the growth of epithelial tumors by mediating increased proliferation and survival. (PMID: 24489573;3049907;21663408)
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for APC IL-4 antibody APC-98360-2 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

