CoraLite® Plus 750 Anti-Mouse IL-4 Rabbit Recombinant Antibody

• 

  FC experiment of Transfected HEK-293T using CL750-98360-2

  1x10^6 HEK-293T cells or IL-4 transfected HEK-293T cells were intracellularly stained with 0.25 ug CoraLite® Plus 750 Anti-Mouse IL-4 Rabbit RecAb (CL750-98360-2, Clone: 242736G8). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).

• 

  FC experiment of Transfected HEK-293T using CL750-98360-2

  1x10^6 HEK-293T cells or IL-4 transfected HEK-293T cells were intracellularly stained with 0.25 ug CoraLite® Plus 750 Anti-Mouse IL-4 Rabbit RecAb (CL750-98360-2, Clone:242736G8) (red), or CoraLite® Plus 750 Rabbit IgG Isotype Control Recombinant Antibody (CL750-98136, Clone: 240953C9) (blue). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).

IL-4 Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. CL750-98360-2

Clone No.242736G8

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC (Intra)

Synonyms

242736G8, Il 4, Il4, interleukin 4

---

Tested Applications

• Positive FC (Intra) detected in: Transfected HEK-293T cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL750-98360-2 targets IL-4 in FC (Intra) applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3750

  Product name: Recombinant Mouse IL-4 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 21-140 aa of BC027514

  Sequence: HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS

• Full Name: interleukin 4
• GenBank Accession Number: BC027514
• Gene Symbol: IL-4
• Gene ID (NCBI): 16189
• Conjugate: CoraLite® Plus 750 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 755 nm / 780 nm
• Excitation Laser: Red Laser (633 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P07750
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Interleukin-4 (IL-4), a member of the α-helical cytokine family, is produced by activated CD4+ T cells, basophils, and mast cells. It promotes the proliferation and differentiation of antigen-presenting cells. IL-4 also plays a pivotal role in antibody isotype switching and stimulates the production of IgE. This cytokine has been applied in the treatment of autoimmune disorders like multiple myeloma, cancer, psoriasis, and arthritis. IL-4 has also been extensively applied to inhibit detrimental effect of Th1. It may promote the growth of epithelial tumors by mediating increased proliferation and survival. (PMID: 24489573;3049907;21663408)