IL-9 Monoclonal antibody, PBS Only

• 

  WB analysis of Recombinant protein using 66144-1-Ig (same clone as 66144-1-PBS)

  Recombinant protein were subjected to SDS PAGE followed by western blot with 66144-1-Ig (IL9 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66144-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 66144-1-Ig (same clone as 66144-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66144-1-Ig (IL-9 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66144-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 66144-1-Ig (same clone as 66144-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66144-1-Ig (IL-9 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66144-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human tonsillitis using 66144-1-Ig (same clone as 66144-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human tonsillitis tissue using IL-9 antibody (66144-1-Ig, Clone: 1F3A11 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66144-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human tonsillitis using 66144-1-Ig (same clone as 66144-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human tonsillitis tissue using IL-9 antibody (66144-1-Ig, Clone: 1F3A11 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66144-1-PBS in a different storage buffer formulation.

IL-9 Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 66144-1-PBS

Clone No.1F3A11

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

IL9, 1F3A11, IL 9, interleukin 9, interleukin9

---

Product Information

66144-1-PBS targets IL-9 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21435

  Product name: Recombinant human IL-9 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 31-144 aa of BC066284

  Sequence: NFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI

• Full Name: interleukin 9
• Calculated Molecular Weight: 144 aa, 16 kDa
• Observed Molecular Weight: 19 kDa
• GenBank Accession Number: BC066284
• Gene Symbol: IL9
• Gene ID (NCBI): 3578
• RRID: AB_2881541
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P15248
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Interleukin 9 (IL-9) is a γc-family cytokine that is highly produced by T-helper 9 (Th9) cells. IL-9 could promote the survival and activation of various cellular targets, including mast cells, B cells, T cells, and structural cells. Its expression is considered a hallmark of Th2-lineage cells. Primarily studied in Th2-type immunity, IL-9 was shown to be involved in asthma, allergy, and host defense against helminth infections. IL-9 also stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes.(PMID: 38864109; PMID: 29038115; PMID: 9505195; PMID: 29703631)