Product Information
66144-1-PBS targets IL-9 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Mouse / IgG2b |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag21435 Product name: Recombinant human IL-9 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 31-144 aa of BC066284 Sequence: NFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI Predict reactive species |
Full Name | interleukin 9 |
Calculated Molecular Weight | 144 aa, 16 kDa |
Observed Molecular Weight | 19 kDa |
GenBank Accession Number | BC066284 |
Gene Symbol | IL9 |
Gene ID (NCBI) | 3578 |
RRID | AB_2881541 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P15248 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
Interleukin 9 (IL-9) is a γc-family cytokine that is highly produced by T-helper 9 (Th9) cells. IL-9 could promote the survival and activation of various cellular targets, including mast cells, B cells, T cells, and structural cells. Its expression is considered a hallmark of Th2-lineage cells. Primarily studied in Th2-type immunity, IL-9 was shown to be involved in asthma, allergy, and host defense against helminth infections. IL-9 also stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes.(PMID: 38864109; PMID: 29038115; PMID: 9505195; PMID: 29703631)