Tested Applications
| Positive WB detected in | Recombinant protein, Recombinant protein protein |
| Positive IHC detected in | human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human tonsillitis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)-P | IF-P : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66144-1-Ig targets IL-9 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21435 Product name: Recombinant human IL-9 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 31-144 aa of BC066284 Sequence: NFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI Predict reactive species |
| Full Name | interleukin 9 |
| Calculated Molecular Weight | 144 aa, 16 kDa |
| Observed Molecular Weight | 19 kDa |
| GenBank Accession Number | BC066284 |
| Gene Symbol | IL9 |
| Gene ID (NCBI) | 3578 |
| RRID | AB_2881541 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P15248 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Interleukin 9 (IL-9) is a γc-family cytokine that is highly produced by T-helper 9 (Th9) cells. IL-9 could promote the survival and activation of various cellular targets, including mast cells, B cells, T cells, and structural cells. Its expression is considered a hallmark of Th2-lineage cells. Primarily studied in Th2-type immunity, IL-9 was shown to be involved in asthma, allergy, and host defense against helminth infections. IL-9 also stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes.(PMID: 38864109; PMID: 29038115; PMID: 9505195; PMID: 29703631)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for IL-9 antibody 66144-1-Ig | Download protocol |
| IHC protocol for IL-9 antibody 66144-1-Ig | Download protocol |
| WB protocol for IL-9 antibody 66144-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-IL-9 antibody (Cat# 66144-1-Ig) has 9 total citations spanning journals including Cell Reports in Medicine, International Journal of Biological Macromolecules, Cancer Immunology & Immunotherapy, Biomolecules, Tissue & Cell, BMC Immunology, FEBS Open Bio, Journal of Tropical Medicine, and Clinical, Cosmetic and Investigational Dermatology. Research fields encompass cytokine biology, immune checkpoint regulation, infectious disease, oncology, dermatology, cardiovascular pathology, and autoimmune disorders, with applications in WB, IF, and IHC across human, mouse, and rat species.
| Species | Application | Title |
|---|---|---|
Cell Rep Med Deficiency of the CD155-CD96 immune checkpoint controls IL-9 production in giant cell arteritis | ||
Int J Biol Macromol EgG1Y162 protein from Echinococcus granulosus modulates the immune functions of mouse splenic lymphocytes and regulates Th9 cells | ||
Cancer Immunol Immunother Impact of innate lymphoid cell type 2 in chronic lymphocytic leukemia on the function of treg and CD8+ T cells through IL-9 | ||
Biomolecules Association of IL-9 Cytokines with Hepatic Injury in Echinococcus granulosus Infection | ||
Tissue Cell Adiponectin attenuates atherosclerosis via macrophage polarization-mediated T Cell exhaustion by modulating the NF-κB p65/PI3K/Akt signaling pathway | ||
BMC Immunol Peripheral immune signatures associated with invasive behavior in pituitary neuroendocrine tumor: a blood-based analysis. |
