Tested Applications
| Positive WB detected in | Recombinant protein, Recombinant protein protein |
| Positive IHC detected in | human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human tonsillitis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)-P | IF-P : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
| IHC | See 3 publications below |
| IF | See 2 publications below |
Product Information
66144-1-Ig targets IL-9 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21435 Product name: Recombinant human IL-9 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 31-144 aa of BC066284 Sequence: NFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI Predict reactive species |
| Full Name | interleukin 9 |
| Calculated Molecular Weight | 144 aa, 16 kDa |
| Observed Molecular Weight | 19 kDa |
| GenBank Accession Number | BC066284 |
| Gene Symbol | IL9 |
| Gene ID (NCBI) | 3578 |
| RRID | AB_2881541 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P15248 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Interleukin 9 (IL-9) is a γc-family cytokine that is highly produced by T-helper 9 (Th9) cells. IL-9 could promote the survival and activation of various cellular targets, including mast cells, B cells, T cells, and structural cells. Its expression is considered a hallmark of Th2-lineage cells. Primarily studied in Th2-type immunity, IL-9 was shown to be involved in asthma, allergy, and host defense against helminth infections. IL-9 also stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes.(PMID: 38864109; PMID: 29038115; PMID: 9505195; PMID: 29703631)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for IL-9 antibody 66144-1-Ig | Download protocol |
| IHC protocol for IL-9 antibody 66144-1-Ig | Download protocol |
| WB protocol for IL-9 antibody 66144-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
FEBS Open Bio Bach2 overexpression represses Th9 cell differentiation by suppressing IRF4 expression in systemic lupus erythematosus. | ||
J Trop Med A Series of 35 Cutaneous Infections Caused by Mycobacterium marinum in Han Chinese Population | ||
Clin Cosmet Investig Dermatol Higher IL-9 Level is Associated with Psoriasis Vulgaris Complicated by Metabolic Syndrome | ||
Cancer Immunol Immunother Impact of innate lymphoid cell type 2 in chronic lymphocytic leukemia on the function of treg and CD8+ T cells through IL-9 | ||
Cell Rep Med Deficiency of the CD155-CD96 immune checkpoint controls IL-9 production in giant cell arteritis | ||
Biomolecules Association of IL-9 Cytokines with Hepatic Injury in Echinococcus granulosus Infection |









