IL-9 Monoclonal antibody

• 

  WB analysis of Recombinant protein using 66144-1-Ig

  Recombinant protein were subjected to SDS PAGE followed by western blot with 66144-1-Ig (IL9 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human tonsillitis using 66144-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66144-1-Ig (IL-9 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 66144-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66144-1-Ig (IL-9 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human tonsillitis using 66144-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human tonsillitis tissue using IL-9 antibody (66144-1-Ig, Clone: 1F3A11 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human tonsillitis using 66144-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human tonsillitis tissue using IL-9 antibody (66144-1-Ig, Clone: 1F3A11 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

IL-9 Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 66144-1-Ig

Clone No.1F3A11

Publications(8)

Host / Isotype

Mouse / IgG2b

Reactivity

human and More (2)

Applications

WB, IHC, IF-P, ELISA

Synonyms

IL9, 1F3A11, IL 9, interleukin 9, interleukin9

---

Tested Applications

• Positive WB detected in: Recombinant protein, Recombinant protein protein
• Positive IHC detected in: human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human tonsillitis tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)-P: IF-P : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 3 publications below
• IF: See 2 publications below

Product Information

66144-1-Ig targets IL-9 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21435

  Product name: Recombinant human IL-9 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 31-144 aa of BC066284

  Sequence: NFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI

• Full Name: interleukin 9
• Calculated Molecular Weight: 144 aa, 16 kDa
• Observed Molecular Weight: 19 kDa
• GenBank Accession Number: BC066284
• Gene Symbol: IL9
• Gene ID (NCBI): 3578
• RRID: AB_2881541
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P15248
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Interleukin 9 (IL-9) is a γc-family cytokine that is highly produced by T-helper 9 (Th9) cells. IL-9 could promote the survival and activation of various cellular targets, including mast cells, B cells, T cells, and structural cells. Its expression is considered a hallmark of Th2-lineage cells. Primarily studied in Th2-type immunity, IL-9 was shown to be involved in asthma, allergy, and host defense against helminth infections. IL-9 also stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes.(PMID: 38864109; PMID: 29038115; PMID: 9505195; PMID: 29703631)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat,human	WB	Int J Biol Macromol; EgG1Y162 protein from Echinococcus granulosus modulates the immune functions of mouse splenic lymphocytes and regulates Th9 cells; Authors - Xia Chen
human	WB	FEBS Open Bio; Bach2 overexpression represses Th9 cell differentiation by suppressing IRF4 expression in systemic lupus erythematosus.; Authors - Yujun Sheng
human	IF	Cancer Immunol Immunother; Impact of innate lymphoid cell type 2 in chronic lymphocytic leukemia on the function of treg and CD8+ T cells through IL-9; Authors - Ruixue Yang
mouse		Cell Rep Med; Deficiency of the CD155-CD96 immune checkpoint controls IL-9 production in giant cell arteritis; Authors - Shozo Ohtsuki
human	IHC	Clin Cosmet Investig Dermatol; Higher IL-9 Level is Associated with Psoriasis Vulgaris Complicated by Metabolic Syndrome; Authors - Liang Yan
		Tissue Cell; Adiponectin attenuates atherosclerosis via macrophage polarization-mediated T Cell exhaustion by modulating the NF-κB p65/PI3K/Akt signaling pathway; Authors - Man Qin