Tested Applications
| Positive IHC detected in | human stomach cancer tissue, human pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below | 
| IHC | See 2 publications below | 
| IF | See 1 publications below | 
| ELISA | See 1 publications below | 
Product Information
66196-1-Ig targets IL-23 p19 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human | 
| Cited Reactivity | human, mouse | 
| Host / Isotype | Mouse / IgG1 | 
| Class | Monoclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag19406 Product name: Recombinant human IL-23A protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 17-189 aa of BC066268 Sequence: AQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP Predict reactive species | 
                                    
| Full Name | interleukin 23, alpha subunit p19 | 
| Calculated Molecular Weight | 189 aa, 21 kDa | 
| GenBank Accession Number | BC066268 | 
| Gene Symbol | IL23A | 
| Gene ID (NCBI) | 51561 | 
| RRID | AB_2881589 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Protein G purification | 
| UNIPROT ID | Q9NPF7 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Background Information
Interleukin 23 (IL-23) is a member of the IL12 cytokine family and composed of two subunits, IL12p40 and IL23p19. It is produced by antigen presenting cells and has been shown to promote the production and survival of a distinct lineage of T-cells called TH17 cells. A functional receptor for IL-23 (the IL-23 receptor) has been identified and is composed of Il-12Rβ1 and IL-23R. IL-23 is expressed chiefly by the macrophages and DCs. The IL-23R is found on memory T cells, NKT cells, macrophages, DCs, and naive T cells upon activation by TGF-βand IL-6. The main biological effects of IL-23 identified initially consist of stimulation of antigen presentation by DCs, T cell differentiation to Th17 cells, and production of interferon-γ (IFN-γ). IL-23 acts also as an end-stage effector cytokine through direct action on macrophages.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for IL-23 p19 antibody 66196-1-Ig | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
Thyroid A MULTICENTER, SINGLE-BLIND, CASE-CONTROL, IMMUNOHISTOCHEMICAL STUDY OF ORBITAL TISSUE IN THYROID EYE DISEASE | ||
J Immunol Polarization and β-Glucan Reprogram Immunomodulatory Metabolism in Human Macrophages and Ex Vivo in Human Lung Cancer Tissues | ||
Cancer Lett PDE4D/cAMP/IL-23 axis determines the immunotherapy efficacy of lung adenocarcinoma via activating the IL-9 autocrine loop of cytotoxic T lymphocytes | ||
Sci Rep Chemotherapy-induced high expression of IL23A enhances efficacy of anti-PD-1 therapy in TNBC by co-activating the PI3K-AKT signaling pathway of CTLs | ||
Toxicol Res (Camb) Zerumbone attenuates the excessive proliferation of keratinocytes in psoriasis mice through regulating NLRP3/NF-κB pathway | ||
Gut IL23 induces IL23R recycling and amplifies innate receptor-induced signalling and cytokines in human macrophages, and the IBD-protective IL23R R381Q variant modulates these outcomes. | 







