IL-23 p19 Monoclonal antibody, PBS Only

IL-23 p19 Monoclonal Antibody for IHC, Indirect ELISA
Cat No. 66196-1-PBS
Clone No.1D5D3

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IHC, Indirect ELISA

IL23A, IL-23 subunit alpha, IL 23p19, IL 23A, IL 23 subunit alpha

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66196-1-PBS targets IL-23 p19 in IHC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag19406

Product name: Recombinant human IL-23A protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 17-189 aa of BC066268

Sequence: AQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP

Predict reactive species
Full Name interleukin 23, alpha subunit p19
Calculated Molecular Weight 189 aa, 21 kDa
GenBank Accession NumberBC066268
Gene Symbol IL23A
Gene ID (NCBI) 51561
RRIDAB_2881589
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9NPF7
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Interleukin 23 (IL-23) is a member of the IL12 cytokine family and composed of two subunits, IL12p40 and IL23p19. It is produced by antigen presenting cells and has been shown to promote the production and survival of a distinct lineage of T-cells called TH17 cells. A functional receptor for IL-23 (the IL-23 receptor) has been identified and is composed of Il-12Rβ1 and IL-23R. IL-23 is expressed chiefly by the macrophages and DCs. The IL-23R is found on memory T cells, NKT cells, macrophages, DCs, and naive T cells upon activation by TGF-βand IL-6. The main biological effects of IL-23 identified initially consist of stimulation of antigen presentation by DCs, T cell differentiation to Th17 cells, and production of interferon-γ (IFN-γ). IL-23 acts also as an end-stage effector cytokine through direct action on macrophages.

Loading...
||
New chat Able
正在加载,请稍候...