Tested Applications
Positive WB detected in | rat liver tissue, A549 cells, SGC-7901 cells |
Positive IP detected in | mouse liver tissue |
Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 4 publications below |
WB | See 14 publications below |
IHC | See 2 publications below |
IF | See 2 publications below |
IP | See 2 publications below |
Product Information
24766-1-AP targets INSIG2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat, monkey |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag14072 Product name: Recombinant human INSIG2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 79-139 aa of BC022475 Sequence: TASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINHASAKVDFDNNIQLSLTLAA Predict reactive species |
Full Name | INSIG 2 |
Calculated Molecular Weight | 225 aa, 25 kDa |
Observed Molecular Weight | 30 kDa |
GenBank Accession Number | BC022475 |
Gene Symbol | INSIG2 |
Gene ID (NCBI) | 51141 |
RRID | AB_2811285 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9Y5U4 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
INSIG2 mediates feedback control of cholesterol synthesis by controlling SCAP and HMGCR. INSIG2 may bring HMGCR into ubiquitin-mediated proteasomal degradation. Insig2 protein are endoplasmic reticulum proteins that block the processing of sterol regulatory element binding proteins (SREBPs) by binding to SREBP cleavage-activating protein (SCAP), and thus prevent SCAP from escorting SREBPs to the Golgi. INSIG-2 may play an important role in therapy of hypercholesterolemia.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for INSIG2 antibody 24766-1-AP | Download protocol |
IHC protocol for INSIG2 antibody 24766-1-AP | Download protocol |
IF protocol for INSIG2 antibody 24766-1-AP | Download protocol |
IP protocol for INSIG2 antibody 24766-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nature The gluconeogenic enzyme PCK1 phosphorylates INSIG1/2 for lipogenesis.
| ||
Mol Metab CD36 promotes de novo lipogenesis in hepatocytes through INSIG2-dependent SREBP1 processing.
| ||
Int J Biol Sci The GR-gp78 Pathway is involved in Hepatic Lipid Accumulation Induced by Overexpression of 11β-HSD1. | ||
Am J Cancer Res p38α/S1P/SREBP2 activation by the SAM-competitive EZH2 inhibitor GSK343 limits its anticancer activity but creates a druggable vulnerability in hepatocellular carcinoma. | ||
Proteomes A Multi-Level Systems Biology Analysis of Aldrin's Metabolic Effects on Prostate Cancer Cells
| ||
Nat Commun In vivo PAR-CLIP (viP-CLIP) of liver TIAL1 unveils targets regulating cholesterol synthesis and secretion |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Zach (Verified Customer) (09-12-2025) | Did not detect endogenous Insig2 but detect transgenically overexpressed ones.
|