Tested Applications
| Positive WB detected in | rat liver tissue, A549 cells, SGC-7901 cells |
| Positive IP detected in | mouse liver tissue |
| Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
24766-1-AP targets INSIG2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, monkey |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14072 Product name: Recombinant human INSIG2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 79-139 aa of BC022475 Sequence: TASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINHASAKVDFDNNIQLSLTLAA Predict reactive species |
| Full Name | INSIG 2 |
| Calculated Molecular Weight | 225 aa, 25 kDa |
| Observed Molecular Weight | 30 kDa |
| GenBank Accession Number | BC022475 |
| Gene Symbol | INSIG2 |
| Gene ID (NCBI) | 51141 |
| RRID | AB_2811285 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y5U4 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
INSIG2 mediates feedback control of cholesterol synthesis by controlling SCAP and HMGCR. INSIG2 may bring HMGCR into ubiquitin-mediated proteasomal degradation. Insig2 protein are endoplasmic reticulum proteins that block the processing of sterol regulatory element binding proteins (SREBPs) by binding to SREBP cleavage-activating protein (SCAP), and thus prevent SCAP from escorting SREBPs to the Golgi. INSIG-2 may play an important role in therapy of hypercholesterolemia.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for INSIG2 antibody 24766-1-AP | Download protocol |
| IHC protocol for INSIG2 antibody 24766-1-AP | Download protocol |
| IP protocol for INSIG2 antibody 24766-1-AP | Download protocol |
| WB protocol for INSIG2 antibody 24766-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The INSIG2 Polyclonal antibody (Cat# 24766-1-AP) has 22 citations across journals including Nature, Nature Communications, Cell Reports, Redox Biology, FASEB Journal, Cell Death & Disease, and Molecular Metabolism. Research fields span lipid/cholesterol metabolism, ferroptosis, hepatocellular carcinoma, breast cancer, atherosclerosis, rheumatoid arthritis, diabetes, circadian rhythm, and gut microbiome–liver axis studies. Applications are predominantly Western blot and immunoprecipitation, with some IF and IHC.
| Species | Application | Title |
|---|---|---|
Nature The gluconeogenic enzyme PCK1 phosphorylates INSIG1/2 for lipogenesis.
| ||
Cancer Commun (Lond) Simvastatin overcomes the pPCK1-pLDHA-SPRINGlac axis-mediated ferroptosis and chemo-immunotherapy resistance in AKT-hyperactivated intrahepatic cholangiocarcinoma | ||
Nat Commun In vivo PAR-CLIP (viP-CLIP) of liver TIAL1 unveils targets regulating cholesterol synthesis and secretion | ||
Nat Commun A cholesterol-responsive hepatic tRNA-derived small RNA regulates cholesterol homeostasis and atherosclerosis development. | ||
Exp Mol Med Iron overload reprogramming lipid metabolism through the IRP1-SCAP axis in fibroblast-like synoviocytes aggravates bone destruction in rheumatoid arthritis. | ||
Redox Biol Excessive SOX8 reprograms energy and iron metabolism to prime hepatocellular carcinoma for ferroptosis |
Reviews
What customers say
The single review for this product (4/5 stars) was from a Western Blot application on liver tissue at a 1:1000 dilution. The user reported that the antibody did not detect endogenous Insig2, but it successfully detected transgenically overexpressed Insig2. Overall, the feedback suggests the antibody works well for detecting overexpressed targets but may lack sensitivity for endogenous levels in liver samples.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Zach (Verified Customer) (09-12-2025) | Did not detect endogenous Insig2 but detect transgenically overexpressed ones.
|
