Tested Applications
| Positive IF/ICC detected in | HepG2 cells |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-24766 targets INSIG2 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14072 Product name: Recombinant human INSIG2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 79-139 aa of BC022475 Sequence: TASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINHASAKVDFDNNIQLSLTLAA Predict reactive species |
| Full Name | INSIG 2 |
| Calculated Molecular Weight | 225 aa, 25 kDa |
| Observed Molecular Weight | 30 kDa |
| GenBank Accession Number | BC022475 |
| Gene Symbol | INSIG2 |
| Gene ID (NCBI) | 51141 |
| RRID | AB_3672772 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Excitation Laser | Blue laser (488 nm) |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y5U4 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
INSIG2 mediates feedback control of cholesterol synthesis by controlling SCAP and HMGCR. INSIG2 may bring HMGCR into ubiquitin-mediated proteasomal degradation. Insig2 protein are endoplasmic reticulum proteins that block the processing of sterol regulatory element binding proteins (SREBPs) by binding to SREBP cleavage-activating protein (SCAP), and thus prevent SCAP from escorting SREBPs to the Golgi. INSIG-2 may play an important role in therapy of hypercholesterolemia.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL Plus 488 INSIG2 antibody CL488-24766 | Download protocol |
| FC protocol for CL Plus 488 INSIG2 antibody CL488-24766 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



