INTS1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84339-5-RR (same clone as 84339-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84339-5-RR (INTS1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84339-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84339-5-RR

  Biolayer interferometry (BLl) kinetic assays of 84339-5-RR against Human INTS1 were performed. The affinity constant is below 1 pM.

INTS1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 84339-5-PBS

Clone No.241627B1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

KIAA1440, integrator complex subunit 1, INT1, 241627B1

---

Product Information

84339-5-PBS targets INTS1 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag35428

  Product name: Recombinant human INTS1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 280-400 aa of BC069262

  Sequence: GAGSSPHPSLTEEEDSQTELLIAEEKLSPEQEGQLMPRYEELAESVEEYVLDMLRDQLNRRQPIDNVSRNLLRLLTSTCGYKEVRLLAVQKLEMWLQNPKLTRPAQDLLMSVCMNCNTHGS

• Full Name: integrator complex subunit 1
• Observed Molecular Weight: 245 kDa
• GenBank Accession Number: BC069262
• Gene Symbol: INTS1
• Gene ID (NCBI): 26173
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q8N201
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

INTS1 is a component of the Integrator (INT) complex, a complex involved in the small nuclear RNAs (snRNA) U1 and U2 transcription and in their 3'-box-dependent processing.