INTS6 Polyclonal antibody

• 

  WB analysis using 31664-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31664-1-AP (INTS6 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 31664-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31664-1-AP (INTS6 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary cancer using 31664-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 31664-1-AP (INTS6 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

INTS6 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 31664-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

HDB, DICE1, DDX26A, DDX26, DBI1

---

Tested Applications

• Positive WB detected in: DU 145 cells, HuH-7 cells, L02 cells, PC-3 cells, LNCaP cells
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31664-1-AP targets INTS6 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36146

  Product name: Recombinant human INTS6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 672-815 aa of BC039829

  Sequence: VVNNHIGGKGPPAPTTQAQPDLIKPLPLHKISETTNDSIIHDVVENHVADQLSSDITPNAMDTEFSASSPASLLERPTNHMEALGHDHLGTNDLTVGGFLENHEEPRDKEQCAEENIPASSLNKGKKLMHCRSHEEVNTELKAQ

• Full Name: integrator complex subunit 6
• Calculated Molecular Weight: 100 kDa
• Observed Molecular Weight: 130 kDa
• GenBank Accession Number: BC039829
• Gene Symbol: INTS6
• Gene ID (NCBI): 26512
• RRID: AB_3670067
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9UL03
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

INTS6 is a component of the Integrator (INT) complex, a complex involved in the small nuclear RNAs (snRNA) U1 and U2 transcription and in their 3'-box-dependent processing.