Tested Applications
| Positive WB detected in | A549 cells, HAP1 cells, HeLa cells, human placenta tissue, U2OS cells |
| Positive IP detected in | human placenta tissue |
| Positive IHC detected in | human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 2 publications below |
| IHC | See 1 publications below |
Product Information
27224-1-AP targets Integrin alpha-5/CD49e in WB, IHC, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26098 Product name: Recombinant human ITGA5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 874-995 aa of NM_002205 Sequence: PINPKGLELDPEGSLHHQQKREAPSRSSASSGPQILKCPEAECFRLRCELGPLHQQESQSLQLHFRVWAKTFLQREHQPFSLQCEAVYKALKMPYRILPRQLPQKERQVATAVQWTKAEGSY Predict reactive species |
| Full Name | integrin, alpha 5 (fibronectin receptor, alpha polypeptide) |
| Calculated Molecular Weight | 115 kDa |
| Observed Molecular Weight | 135-150 kDa |
| GenBank Accession Number | NM_002205 |
| Gene Symbol | Integrin alpha 5 |
| Gene ID (NCBI) | 3678 |
| RRID | AB_2880807 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P08648 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Integrin alpha-5/CD49e antibody 27224-1-AP | Download protocol |
| IP protocol for Integrin alpha-5/CD49e antibody 27224-1-AP | Download protocol |
| WB protocol for Integrin alpha-5/CD49e antibody 27224-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Clin Transl Hepatol A Prognostic Nomogram for Hepatocellular Carcinoma Based on Wound Healing and Immune Checkpoint Genes | ||
Mol Cancer ZNF460-mediated circRPPH1 promotes TNBC progression through ITGA5-induced FAK/PI3K/AKT activation in a ceRNA manner | ||
Biomater Res Targeting Reprogrammed Cancer-Associated Fibroblasts with Engineered Mesenchymal Stem Cell Extracellular Vesicles for Pancreatic Cancer Treatment
|
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Boyan (Verified Customer) (01-25-2019) | By WB, it labels a band at the expected molecular weight, but this band is very likely not the real protein, because it is increased during adipocyte differentiation, which should be decreased during the process according to literature.By IF, PFA fixation, it labels the protein in the nucleus. But according to literature, it is localised in the cell surface and the Gogli.
|



















