Tested Applications
| Positive WB detected in | HeLa cells, MDA-MB-231 cells, OVCAR-3 cells, SKOV-3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
30010-1-AP targets ITGBL1 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag31989 Product name: Recombinant human ITGBL1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 246-374 aa of BC036788 Sequence: VCGECTCHDVDPTGDWGDIHGDTCECDERDCRAVYDRYSDDFCSGHGQCNCGRCDCKAGWYGKKCEHPQSCTLSAEESIRKCQGSSDLPCSGRGKCECGKCTCYPPGDRRVYGKTCECDDRRCEDLDGV Predict reactive species |
| Full Name | integrin, beta-like 1 (with EGF-like repeat domains) |
| Calculated Molecular Weight | 494 aa, 54 kDa |
| Observed Molecular Weight | 50 kDa |
| GenBank Accession Number | BC036788 |
| Gene Symbol | ITGBL1 |
| Gene ID (NCBI) | 9358 |
| RRID | AB_3086208 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O95965 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Integrin beta-like protein 1 (ITGBL1), also named as TIED or OSCP, is a secreted protein that contains ten tandem EGF-like repeats strikingly similar to those found in the cysteine-rich "stalk-like" structure of integrin beta subunits (PMID: 10051402). ITGBL1 participates in the regulation of fibrogenesis via interactions with transforming growth factor beta 1 (PMID: 28262670). ITGBL1 is also involved in the development and metastasis of many tumors (PMID: 32211321; 29772438; 26060017; 31190876).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for ITGBL1 antibody 30010-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

