Tested Applications
| Positive WB detected in | Jurkat cells, mouse spleen tissue | 
| Positive IF/ICC detected in | Jurkat cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below | 
Product Information
21525-1-AP targets ITK in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat | 
| Cited Reactivity | human | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag16132 Product name: Recombinant human ITK protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 151-258 aa of BC109077 Sequence: NASKKPLPPTPEDNRRPLWEPEETVVIALYDYQTNDPQELALRRNEEYCLLDSSEIHWWRVQDRNGHEGYVPSSYLVEKSPNNLETYEWYNKSISRDKAEKLLLDTGK Predict reactive species | 
                                    
| Full Name | IL2-inducible T-cell kinase | 
| Calculated Molecular Weight | 620 aa, 72 kDa | 
| Observed Molecular Weight | 68-72 kDa | 
| GenBank Accession Number | BC109077 | 
| Gene Symbol | ITK | 
| Gene ID (NCBI) | 3702 | 
| RRID | AB_10733884 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | Q08881 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ITK antibody 21525-1-AP | Download protocol | 
| WB protocol for ITK antibody 21525-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
J Immunol Role of Signal-Transducing Adaptor Protein-1 for T Cell Activation and Pathogenesis of Autoimmune Demyelination and Airway Inflammation | ||
Cytotherapy Bruton tyrosine kinase inhibitors preserve anti-CD19 chimeric antigen receptor T-cell functionality and reprogram tumor micro-environment in B-cell lymphoma | 









