CoraLite®555-conjugated ITK Polyclonal antibody

• 

  IF Staining of Jurkat using CL555-21525

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using CoraLite®555 ITK antibody (CL555-21525) at dilution of 1:200.

ITK Polyclonal Antibody for IF/ICC

Cat No. CL555-21525

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

EMT, IL2 inducible T cell kinase, ITK, Kinase EMT, LYK, PSCTK2, T cell specific kinase, Tyrosine protein kinase Lyk

---

Tested Applications

• Positive IF/ICC detected in: Jurkat cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL555-21525 targets ITK in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16132

  Product name: Recombinant human ITK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 151-258 aa of BC109077

  Sequence: NASKKPLPPTPEDNRRPLWEPEETVVIALYDYQTNDPQELALRRNEEYCLLDSSEIHWWRVQDRNGHEGYVPSSYLVEKSPNNLETYEWYNKSISRDKAEKLLLDTGK

• Full Name: IL2-inducible T-cell kinase
• Calculated Molecular Weight: 620 aa, 72 kDa
• Observed Molecular Weight: 68-72 kDa
• GenBank Accession Number: BC109077
• Gene Symbol: ITK
• Gene ID (NCBI): 3702
• RRID: AB_2919639
• Conjugate: CoraLite®555 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 557 nm / 570nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q08881
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.