Tested Applications
| Positive WB detected in | Jurkat cells, PBMC cells | 
| Positive IF/ICC detected in | Jurkat cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67703-1-Ig targets ITK in WB, IF/ICC, ELISA applications and shows reactivity with Human samples.
| Tested Reactivity | Human | 
| Host / Isotype | Mouse / IgG2a | 
| Class | Monoclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag17087 Product name: Recombinant human ITK protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 151-258 aa of BC109077 Sequence: NASKKPLPPTPEDNRRPLWEPEETVVIALYDYQTNDPQELALRRNEEYCLLDSSEIHWWRVQDRNGHEGYVPSSYLVEKSPNNLETYEWYNKSISRDKAEKLLLDTGK Predict reactive species | 
                                    
| Full Name | IL2-inducible T-cell kinase | 
| Calculated Molecular Weight | 620 aa, 72 kDa | 
| Observed Molecular Weight | 70 kDa | 
| GenBank Accession Number | BC109077 | 
| Gene Symbol | ITK | 
| Gene ID (NCBI) | 3702 | 
| RRID | AB_2882895 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Protein A purification | 
| UNIPROT ID | Q08881 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Background Information
ITK is a member of Tec family (BTK, ITK, Tec, BMX and RLK), which expressed in normal T-lymphocytes and T-cell associated hematopoietic malignancies and have confirmed its critical role in regulating T lymphocyte function in EBV-driven lymphoproliferative disease and immune-mediated disorders. Tec kinase family members shares similarities structure, consisting of PH domain, SH3 domain, SH2 domain and kinase domain. Loss of function mutations in ITK results in hypogammaglobulinemia and CD4+ T cell loss in humans, and the patients often present with EBV-associated B cell lymphoproliferative syndrome (PMID: 30814910, PMID: 31025232).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for ITK antibody 67703-1-Ig | Download protocol | 
| IF protocol for ITK antibody 67703-1-Ig | Download protocol | 
| WB protocol for ITK antibody 67703-1-Ig | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 





