CoraLite® Plus 488-conjugated ITK Monoclonal antibody

ITK Monoclonal Antibody for IF/ICC
Cat No. CL488-67703
Clone No.1F9D8

Host / Isotype

Mouse / IgG2a

Reactivity

Human

Applications

IF/ICC

EMT, IL2 inducible T cell kinase, ITK, Kinase EMT, LYK, PSCTK2, T cell specific kinase, Tyrosine protein kinase Lyk

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inJurkat cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67703 targets ITK in IF/ICC applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17087

Product name: Recombinant human ITK protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 151-258 aa of BC109077

Sequence: NASKKPLPPTPEDNRRPLWEPEETVVIALYDYQTNDPQELALRRNEEYCLLDSSEIHWWRVQDRNGHEGYVPSSYLVEKSPNNLETYEWYNKSISRDKAEKLLLDTGK

Predict reactive species
Full Name IL2-inducible T-cell kinase
Calculated Molecular Weight 620 aa, 72 kDa
Observed Molecular Weight70 kDa
GenBank Accession NumberBC109077
Gene Symbol ITK
Gene ID (NCBI) 3702
RRIDAB_2919525
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ08881
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

ITK is a member of Tec family (BTK, ITK, Tec, BMX and RLK), which expressed in normal T-lymphocytes and T-cell associated hematopoietic malignancies and have confirmed its critical role in regulating T lymphocyte function in EBV-driven lymphoproliferative disease and immune-mediated disorders. Tec kinase family members shares similarities structure, consisting of PH domain, SH3 domain, SH2 domain and kinase domain. Loss of function mutations in ITK results in hypogammaglobulinemia and CD4+ T cell loss in humans, and the patients often present with EBV-associated B cell lymphoproliferative syndrome (PMID: 30814910, PMID: 31025232).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 ITK antibody CL488-67703Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...