Rat IL-1 beta Recombinant monoclonal antibody, PBS Only

IL-1 beta Uni-rAb® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 84274-1-PBS
Clone No.241001H8

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Il1 beta, Il1b, 241001H8, IL 1 beta, IL-1 beta,IL 1 beta,IL1beta

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84274-1-PBS targets IL-1 beta in WB, IF/ICC, Indirect ELISA applications and shows reactivity with mouse, rat samples.

Tested Reactivity mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg31371

Product name: Recombinant Rat IL-1 beta protein (Myc Tag, His Tag)

Source: mammalian cells-derived, pHZ-KIsec

Tag: Myc & 6*His

Domain: 117-268 aa of NM_031512

Sequence: VPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS

Predict reactive species
Full Name interleukin 1 beta
Calculated Molecular Weight 31 kDa
Observed Molecular Weight31 kDa
GenBank Accession NumberNM_031512
Gene Symbol IL-1 beta
Gene ID (NCBI) 24494
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ63264
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Interleukin-1, produced mainly by blood monocytes, mediates the panoply of host reactions collectively known as acute phase response. It is identical to endogenous pyrogen. The multiple biologic activities that define IL1 are properties of a 15- to 18-kD protein that is derived from a 30- to 35-kD precursor. Interleukin 1β (IL-1B) is a member of the interleukin 1 cytokine family. It is a pro-inflammatory cytokine against infection, playing an important role in the pathogenesis of cancers. It signals through various adaptor proteins and kinases that lead to activation of numerous downstream targets.

Loading...
||
New chat

Able

正在加载,请稍候...