IL-1 beta Recombinant monoclonal antibody

• 

  WB analysis of NR8383 using 84274-1-RR

  LPS and Brefeldin A treated NR8383 cells were subjected to SDS PAGE followed by western blot with 84274-1-RR (Il1 beta antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of RAW 264.7 using 84274-1-RR

  Immunofluorescent analysis of (4% PFA) fixed LPS and Brefeldin A treated RAW 264.7 cells using IL-1 beta antibody (84274-1-RR, Clone: 241001H8 ) at dilution of 1:4000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  Affinity and Kinetic Characterization of 84274-1-RR

  Biolayer interferometry (BLl) kinetic assays of 84274-1-RR against Rat Il1 beta were performed. The affinity constant is 0.734 nM.

IL-1 beta Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 84274-1-RR

Clone No.241001H8

Host / Isotype

Rabbit / IgG

Reactivity

rat

Applications

WB, IF/ICC, ELISA

Synonyms

Il1 beta, Il1b, 241001H8, IL 1 beta, IL-1 beta,IL 1 beta,IL1beta

---

Tested Applications

• Positive WB detected in: LPS and Brefeldin A treated NR8383 cells
• Positive IF/ICC detected in: LPS and Brefeldin A treated RAW 264.7 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:2000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84274-1-RR targets IL-1 beta in WB, IF/ICC, ELISA applications and shows reactivity with rat samples.

• Tested Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg31371

  Product name: Recombinant Rat IL-1 beta protein (Myc Tag, His Tag)

  Source: mammalian cells-derived, pHZ-KIsec

  Tag: Myc & 6*His

  Domain: 117-268 aa of NM_031512

  Sequence: VPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS

• Full Name: interleukin 1 beta
• Calculated Molecular Weight: 31 kDa
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: NM_031512
• Gene Symbol: IL-1 beta
• Gene ID (NCBI): 24494
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q63264
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Interleukin-1, produced mainly by blood monocytes, mediates the panoply of host reactions collectively known as acute phase response. It is identical to endogenous pyrogen. The multiple biologic activities that define IL1 are properties of a 15- to 18-kD protein that is derived from a 30- to 35-kD precursor. Interleukin 1β (IL-1B) is a member of the interleukin 1 cytokine family. It is a pro-inflammatory cytokine against infection, playing an important role in the pathogenesis of cancers. It signals through various adaptor proteins and kinases that lead to activation of numerous downstream targets.