Product Information
67284-1-PBS targets Ins1 in IHC, IF-P, Indirect ELISA applications and shows reactivity with Rat, mouse samples.
Tested Reactivity | Rat, mouse |
Host / Isotype | Mouse / IgG2a |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag28809 Product name: Recombinant rat Insulin1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 25-87 aa of NM_019129.3 Sequence: MFVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVPQLELGGGPEAGDLQTLALEVAR Predict reactive species |
Full Name | insulin 1 |
Calculated Molecular Weight | 12 kDa |
GenBank Accession Number | NM_019129.3 |
Gene Symbol | Ins1 |
Gene ID (NCBI) | 24505 |
RRID | AB_2882551 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P01322 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |