Rat Ins1 Monoclonal antibody, PBS Only

• 

  IHC staining of rat pancreas using 67284-1-Ig (same clone as 67284-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat pancreas tissue slide using 67284-1-Ig (Insulin1 antibody) at dilution of 1:10000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67284-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat pancreas using 67284-1-Ig (same clone as 67284-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat pancreas tissue slide using 67284-1-Ig (Insulin1 antibody) at dilution of 1:10000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67284-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse pancreas using 67284-1-Ig (same clone as 67284-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 67284-1-Ig (Insulin1 antibody) at dilution of 1:10000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67284-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse pancreas using 67284-1-Ig (same clone as 67284-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 67284-1-Ig (Insulin1 antibody) at dilution of 1:10000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67284-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat pancreas using 67284-1-Ig (same clone as 67284-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed rat pancreas tissue using Ins1 antibody (67284-1-Ig, Clone: 3A11C1 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67284-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat pancreas using 67284-1-Ig (same clone as 67284-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed rat pancreas tissue using Ins1 antibody (67284-1-Ig, Clone: 3A11C1 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67284-1-PBS in a different storage buffer formulation.

Ins1 Monoclonal Antibody for IHC, IF-P, Indirect ELISA

Cat No. 67284-1-PBS

Clone No.3A11C1

Host / Isotype

Mouse / IgG2a

Reactivity

Rat, mouse

Applications

IHC, IF-P, Indirect ELISA

Synonyms

Ins1, Ins-1

---

Product Information

67284-1-PBS targets Ins1 in IHC, IF-P, Indirect ELISA applications and shows reactivity with Rat, mouse samples.

• Tested Reactivity: Rat, mouse
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28809

  Product name: Recombinant rat Insulin1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 25-87 aa of NM_019129.3

  Sequence: MFVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVPQLELGGGPEAGDLQTLALEVAR

• Full Name: insulin 1
• Calculated Molecular Weight: 12 kDa
• GenBank Accession Number: NM_019129.3
• Gene Symbol: Ins1
• Gene ID (NCBI): 24505
• RRID: AB_2882551
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P01322
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.