Tested Applications
Positive IHC detected in | rat pancreas tissue, mouse pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | rat pancreas tissue |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:5000-1:10000 |
Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
67284-1-Ig targets Ins1 in IHC, IF-P, ELISA applications and shows reactivity with Rat, mouse samples.
Tested Reactivity | Rat, mouse |
Host / Isotype | Mouse / IgG2a |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag28809 Product name: Recombinant rat Insulin1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 25-87 aa of NM_019129.3 Sequence: MFVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVPQLELGGGPEAGDLQTLALEVAR Predict reactive species |
Full Name | insulin 1 |
Calculated Molecular Weight | 12 kDa |
GenBank Accession Number | NM_019129.3 |
Gene Symbol | Ins1 |
Gene ID (NCBI) | 24505 |
RRID | AB_2882551 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P01322 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for Ins1 antibody 67284-1-Ig | Download protocol |
IF protocol for Ins1 antibody 67284-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |