Integrin beta 5 Recombinant monoclonal antibody, PBS Only (Capture)

Integrin beta 5 Uni-rAb® Recombinant Antibody for WB, IHC, FC (Intra), Sandwich ELISA, Indirect ELISA

Cat No. 83514-3-PBS
Clone No.240401G11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, FC (Intra), Sandwich ELISA, Indirect ELISA

ITGB5, 240401G11, Integrin beta-5, integrin, beta 5

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83514-3-PBS targets Integrin beta 5 as part of a matched antibody pair:

MP00512-4: 83514-3-PBS capture and 83514-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag29783

Product name: Recombinant human Integrin beta-5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 24-126 aa of BC006541

Sequence: GLNICTSGSATSCEECLLIHPKCAWCSKEDFGSPRSITSRCDLRANLVKNGCGGEIESPASSFHVLRSLPLSSKGSGSAGWDVIQMTPQEIAVNLRPGDKTTF

Predict reactive species
Full Name integrin, beta 5
Calculated Molecular Weight 88 kDa
Observed Molecular Weight88-100 kDa
GenBank Accession NumberBC006541
Gene Symbol Integrin beta 5
Gene ID (NCBI) 3693
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP18084
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ITGB5, also known as Integrin beta-5. It is expected to be located in the plasma membrane and mitochondria, which is i ubiquitinated in placenta and gall bladder. ITGB5 is a member of integrins and was proved to be associated with pathological processes in several tumors (PMID: 34966851). It is reported that TGB5 is highly expressed in hepatocellular carcinoma (HCC), and miR-185 regulates the expression of β- catenin through the ITGB5-dependent manner and affects the proliferation and migration of HCC cells (PMID: 35223869). The molecular weight of ITGB5 is 88 kDa, and the glycosylation modification also exists.

Loading...
||
New chat

Able

正在加载,请稍候...