Integrin beta-5 Recombinant monoclonal antibody

• 

  WB analysis using 83514-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83514-3-RR (Integrin beta-5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary cancer using 83514-3-RR

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 83514-3-RR (Integrin beta-5 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary cancer using 83514-3-RR

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 83514-3-RR (Integrin beta-5 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  FC experiment of HeLa using 83514-3-RR

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug Integrin beta-5 Recombinant antibody (83514-3-RR, Clone:240401G11) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

• 

  Affinity and Kinetic Characterization of 83514-3-RR

  Biolayer interferometry (BLl) kinetic assays of 83514-3-RR against Human Integrin beta-5 were performed. The affinity constant is 0.955 nM.

Integrin beta-5 Uni-rAb^® Recombinant Antibody for WB, IHC, FC (Intra), ELISA

Cat No. 83514-3-RR

Clone No.240401G11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, FC (Intra), ELISA

Synonyms

ITGB5, 240401G11, Integrin beta 5, integrin, beta 5

---

Tested Applications

• Positive WB detected in: A549 cells, HT-29 cells, NIH-H1299 cells
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83514-3-RR targets Integrin beta-5 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag29783

  Product name: Recombinant human Integrin beta-5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 24-126 aa of BC006541

  Sequence: GLNICTSGSATSCEECLLIHPKCAWCSKEDFGSPRSITSRCDLRANLVKNGCGGEIESPASSFHVLRSLPLSSKGSGSAGWDVIQMTPQEIAVNLRPGDKTTF

• Full Name: integrin, beta 5
• Calculated Molecular Weight: 88 kDa
• Observed Molecular Weight: 88-100 kDa
• GenBank Accession Number: BC006541
• Gene Symbol: Integrin beta 5
• Gene ID (NCBI): 3693
• RRID: AB_3671139
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P18084
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ITGB5, also known as Integrin beta-5. It is expected to be located in the plasma membrane and mitochondria, which is i ubiquitinated in placenta and gall bladder. ITGB5 is a member of integrins and was proved to be associated with pathological processes in several tumors (PMID: 34966851). It is reported that TGB5 is highly expressed in hepatocellular carcinoma (HCC), and miR-185 regulates the expression of β- catenin through the ITGB5-dependent manner and affects the proliferation and migration of HCC cells (PMID: 35223869). The molecular weight of ITGB5 is 88 kDa, and the glycosylation modification also exists.