Integrin beta 5 Recombinant monoclonal antibody

Integrin beta 5 Uni-rAb® Recombinant Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 83514-3-RR
Clone No.240401G11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, FC (Intra), ELISA

ITGB5, 240401G11, Integrin beta-5, integrin, beta 5

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, HT-29 cells, NIH-H1299 cells
Positive IHC detected inhuman ovary cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83514-3-RR targets Integrin beta 5 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag29783

Product name: Recombinant human Integrin beta-5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 24-126 aa of BC006541

Sequence: GLNICTSGSATSCEECLLIHPKCAWCSKEDFGSPRSITSRCDLRANLVKNGCGGEIESPASSFHVLRSLPLSSKGSGSAGWDVIQMTPQEIAVNLRPGDKTTF

Predict reactive species
Full Name integrin, beta 5
Calculated Molecular Weight 88 kDa
Observed Molecular Weight88-100 kDa
GenBank Accession NumberBC006541
Gene Symbol Integrin beta 5
Gene ID (NCBI) 3693
RRIDAB_3671139
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP18084
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ITGB5, also known as Integrin beta-5. It is expected to be located in the plasma membrane and mitochondria, which is i ubiquitinated in placenta and gall bladder. ITGB5 is a member of integrins and was proved to be associated with pathological processes in several tumors (PMID: 34966851). It is reported that TGB5 is highly expressed in hepatocellular carcinoma (HCC), and miR-185 regulates the expression of β- catenin through the ITGB5-dependent manner and affects the proliferation and migration of HCC cells (PMID: 35223869). The molecular weight of ITGB5 is 88 kDa, and the glycosylation modification also exists.

Protocols

Product Specific Protocols
FC protocol for Integrin beta 5 antibody 83514-3-RRDownload protocol
IHC protocol for Integrin beta 5 antibody 83514-3-RRDownload protocol
WB protocol for Integrin beta 5 antibody 83514-3-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...