Integrin beta-6 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Integrin beta-6 Polyclonal antibody (28378-1-AP)

Integrin beta-6 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28378-1-AP Copied!

Publications (8)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

Human, Mouse and More (2)

Applications

WB, IHC, IF, ELISA

Synonyms

Integrin beta 6, Integrin beta-6, integrin, beta 6, ITGB6

• 

  WB analysis using 28378-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 28378-1-AP (Integrin beta-6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse lung using 28378-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 28378-1-AP (Integrin beta-6 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse lung using 28378-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 28378-1-AP (Integrin beta-6 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Integrin beta-6 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A431 cells
• Positive IHC detected in: mouse lung tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28378-1-AP targets Integrin beta-6 in WB, IHC, IF, ELISA applications and shows reactivity with Human, Mouse samples.

• Tested Reactivity: Human, Mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29002

  Product name: Recombinant human Integrin beta-6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 596-709 aa of BC121178

  Sequence: DCVCGKCVCTNPGASGPTCERCPTCGDPCNSKRSCIECHLSAAGQAREECVDKCKLAGATISEEEDFSKDGSVSCSLQGENECLITFLITTDNEGKTIIHSINEKDCPKPPNIP

• Full Name: integrin, beta 6
• Calculated Molecular Weight: 788 aa, 86 kDa
• Observed Molecular Weight: 97 kDa
• GenBank Accession Number: BC121178
• Gene Symbol: Integrin beta 6
• Gene ID (NCBI): 3694
• RRID: AB_2918157
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P18564
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ITGB6 belongs to the integrin beta chain family. ITGB6 is a receptor for fibronectin and cytotactin. It recognizes the sequence R-G-D in its ligands. Internalisation of integrin alpha-V/beta-6 via clathrin-mediated endocytosis promotes carcinoma cell invasion.

Publications

What published studies show

The Integrin beta-6 Polyclonal antibody (Cat# 28378-1-AP) has 8 citations published in journals including Sci Adv, Chin Med J, Respir Res, Transl Lung Cancer Res, Front Oncol, PLoS One, Sci China Life Sci, and Cancer Cell Int. Research fields span ARDS/inflammation, pancreatic and gastric cancer, pleural fibrosis, lung adenocarcinoma, odontogenesis, mRNA nanoparticle delivery, and pancreatic cancer prognostic signatures.

Automatically generated from the 8 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	IHC	Sci Adv; Biomimetic targeted self-adaptive nanodrug for inflammation optimization and AT2 cell modulation in precise ARDS therapy; Authors - Cheng Chen
human, mouse	WB,IHC	Chin Med J (Engl); Effect of TGFβ-ITGB6 feedback loop on liver metastasis in SMAD4 wild-type pancreatic cancer.; Authors - Yutong Zhao ; KD Validated
human	WB,IF	Respir Res; Exosomal microRNAs of tuberculous pleural effusion orchestrating TGF-β signaling mediate pleural fibrosis.; Authors - Li-Juan Jiang
human	WB,IHC	Transl Lung Cancer Res; Exosomal ITGB6 from dormant lung adenocarcinoma cells activates cancer-associated fibroblasts by KLF10 positive feedback loop and the TGF-β pathway; Authors - Xiang Feng
human	IHC	Front Oncol; The association and clinicopathological significance of Integrin alphavbeta6 and Rac1 expression in gastric carcinoma; Authors - Junjian Yu
human,mouse	WB	PLoS One; Odontogenesis-associated phosphoprotein (ODAPH) Promotes Ameloblast adhesion and alkaline phosphatase (ALP) expression via LAMC2/ ITGB6/TGF-β1 signaling pathway; Authors - Mingyue Li