Involucrin Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83649-5-RR (same clone as 83649-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83649-5-RR (Involucrin antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83649-5-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin using 83649-5-RR (same clone as 83649-5-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 83649-5-RR (Involucrin antibody) at dilution of 1:800 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83649-5-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin cancer using 83649-5-RR (same clone as 83649-5-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 83649-5-RR (Involucrin antibody) at dilution of 1:800 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83649-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83649-5-RR

  Biolayer interferometry (BLl) kinetic assays of 83649-5-RR against Human Involucrin were performed. The affinity constant is below 1 pM.

Involucrin Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 83649-5-PBS

Clone No.240566D8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

IVL, 240566D8

---

Product Information

83649-5-PBS targets Involucrin in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag29585

  Product name: Recombinant human Involucrin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 234-361 aa of NM_005547

  Sequence: EVPSKQEGQLELSEQQEGQLELSEQQEGQLKHLEHQEGQLEVPEEQMGQLKYLEQQEGQLKHLDQQEKQPELPEQQMGQLKHLEQQEGQPKHLEQQEGQLEQLEEQEGQLKHLEQQEGQLEHLEHQEG

• Full Name: involucrin
• Calculated Molecular Weight: 68 kDa
• Observed Molecular Weight: 140 kDa
• GenBank Accession Number: NM_005547
• Gene Symbol: Involucrin
• Gene ID (NCBI): 3713
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P07476
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Involucrin is a protein precursor of the epidermal cornified envelope that is assembled in the outermost layers of the epidermis. Involucrin expression is restricted to the suprabasal epidermal layers (spinous and granular layers) during normal keratinocyte differentiation and is a useful marker of terminal differentiation. The predicted MW of involucrin is 68 kDa, but it also forms 120 kDa dimers, while different reports provided variable results ranging from 90-140 kDa. (PMID: 11099111, 1503502, 12150517)