JAM2 Polyclonal antibody

• 

  WB analysis using 34226-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 34226-1-AP (JAM2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human placenta using 34226-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 34226-1-AP (JAM2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 34226-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 34226-1-AP (JAM2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human placenta using 34226-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human placenta tissue using JAM2 antibody (34226-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

JAM2 Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 34226-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

Synonyms

CD322, JAM-2, JAM-B, Junctional adhesion molecule 2, Junctional adhesion molecule B

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IHC detected in: human placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human placenta tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

34226-1-AP targets JAM2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg6328

  Product name: Recombinant mouse CD322/JAM-B/VE-JAM protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 29-236 aa of NM_023844.5

  Sequence: FSASKDHRQEVTVIEFQEAILACKTPKKTTSSRLEWKKVGQGVSLVYYQQALQGDFKDRAEMIDFNIRIKNVTRSDAGEYRCEVSAPTEQGQNLQEDKVMLEVLVAPAVPACEVPTSVMTGSVVELRCQDKEGNPAPEYIWFKDGTSLLGNPKGGTHNNSSYTMNTKSGILQFNMISKMDSGEYYCEARNSVGHRRCPGKRMQVDVLN

• Full Name: junction adhesion molecule 2
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: NM_023844.5
• Gene Symbol: Jam2
• Gene ID (NCBI): 67374
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9JI59
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Junctional adhesion molecules (JAMs) are integral membrane proteins belonging to the immunoglobulin (Ig) superfamily. JAMs are expressed by leukocytes, platelets, endothelial, and epithelial cells and localized at the tight junction of polarized cells and on the cell surface of leukocytes. JAM-2, also known as VE-JAM or JAM-B, is specifically expressed in lymphatic endothelial cells and endothelial venules. JAM2 regulates cell-cell adhesion and signaling by interacting with other tight junction proteins such as PAR-3 and ZO-1 (PMID: 14657270; 24595739; 11739175; 12953056).