JAM3 Polyclonal antibody

• 

  WB analysis using 32543-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32543-1-AP (JAM3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

JAM3 Polyclonal Antibody for WB, ELISA

Cat No. 32543-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, ELISA

Synonyms

JAM-2, JAM-3, JAM-C, Junctional adhesion molecule 3, Junctional adhesion molecule C

---

Tested Applications

• Positive WB detected in: mouse heart tissue, mouse kidney tissue, mouse testis tissue, rat heart tissue, rat testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32543-1-AP targets JAM3 in WB, ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg2661

  Product name: Recombinant Mouse JAM-3 protein (rFc Tag)(HPLC verified)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 30-241 aa of NM_023277.4

  Sequence: EAVNLKSSNRNPVVHEFESVELSCIITDSQTSDPRIEWKKIQDGQTTYVYFDNKIQGDLAGRTDVFGKTSLRIWNVTRSDSAIYRCEVVALNDRKEVDEITIELIVQVKPVTPVCRIPAAVPVGKTATLQCQESEGYPRPHYSWYRNDVPLPTDSRANPRFQNSSFHVNSETGTLVFNAVHKDDSGQYYCIASNDAGAARCEGQDMEVYDLN

• Full Name: junction adhesion molecule 3
• Calculated Molecular Weight: 35 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: NM_023277.4
• Gene Symbol: Jam3
• Gene ID (NCBI): 83964
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9D8B7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Junctional adhesion molecule 3 (JAM3) is a type I transmembrane glycoprotein containing two Ig-like domains, which is expressed in various tissues and plays a crucial role in cell junctions, cell polarity, and motility (PMID: 34292449; 28931565). It has been proposed that JAM3 participates in leukocyte-platelet interactions, as well as angiogenesis and brain development (PMID: 12208882; 23255084). JAM3 may also be a new marker for predicting the prognosis and immune functions of bladder cancer patients (PMID: 38400838).