KBTBD6 Polyclonal antibody, PBS Only

• 

  WB analysis using 31743-1-AP (same clone as 31743-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31743-1-AP (KBTBD6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31743-1-PBS in a different storage buffer formulation.

KBTBD6 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 31743-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Kelch repeat and BTB domain-containing protein 6

---

Product Information

31743-1-PBS targets KBTBD6 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36046

  Product name: Recombinant human KBTBD6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 625-674 aa of BC000560

  Sequence: PGQSFLTEEEEIPSESSTEWDLGGFSEPDSESGSSSSLSDDDFWVRVAPQ

• Full Name: kelch repeat and BTB (POZ) domain containing 6
• Observed Molecular Weight: 76 kDa
• GenBank Accession Number: BC000560
• Gene Symbol: KBTBD6
• Gene ID (NCBI): 89890
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q86V97
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

KBTBD6 (Kelch repeat and BTB domain-containing protein 6) is involved in proteasome-mediated ubiquitin-dependent protein catabolic process; protein K48-linked ubiquitination; and Rac protein signal transduction regulation.