Tested Applications
| Positive WB detected in | mouse brain tissue |
| Positive IHC detected in | rat brain tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse cerebellum tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
Product Information
28724-1-AP targets KCC2/SLC12A5 in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, Mouse, Rat samples.
| Tested Reactivity | Human, Mouse, Rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30203 Product name: Recombinant human SLC12A5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 915-1043 aa of BC132670 Sequence: ILKQMHLTKNEREREIQSITDESRGSIRRKNPANTRLRLNVPEETAGDSEEKPEEEVQLIHDQSAPSCPSSSPSPGEEPEGEGETDPEKVHLTWTKDKSVAEKNKGPSPVSSEGIKDFFSMKPEWENLN Predict reactive species |
| Full Name | solute carrier family 12 (potassium-chloride transporter), member 5 |
| Observed Molecular Weight | 130-150 kDa |
| GenBank Accession Number | BC132670 |
| Gene Symbol | KCC2 |
| Gene ID (NCBI) | 57468 |
| RRID | AB_2918195 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9H2X9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
KCC2, encoded by SLC12A5, is a neuron-specific K+-Cl- cotransporter that is essential for Cl- homeostasis and inhibitory synaptic transmission in brain. KCC2 is expressed at high levels in neurons throughout the nervous system. KCC2 deletion caused animal death. Alterations of KCC2 have been linked to neuropathic pain, temporal lobe epilepsy, and other diseases.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for KCC2/SLC12A5 antibody 28724-1-AP | Download protocol |
| IHC protocol for KCC2/SLC12A5 antibody 28724-1-AP | Download protocol |
| WB protocol for KCC2/SLC12A5 antibody 28724-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |













