KCNA1 Monoclonal antibody, PBS Only

• 

  WB analysis using 68008-1-Ig (same clone as 68008-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68008-1-Ig (KCNA1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68008-1-PBS in a different storage buffer formulation.

KCNA1 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68008-1-PBS

Clone No.1D6B9

Host / Isotype

Mouse / IgG2a

Reactivity

Human, Pig, Mouse, Rat, Rabbit

Applications

WB, Indirect ELISA

Synonyms

AEMK, EA1, HBK1, HUK1, KCNA1, KV1.1, MBK1, MK1, RBK1

---

Product Information

68008-1-PBS targets KCNA1 in WB, Indirect ELISA applications and shows reactivity with Human, Pig, Mouse, Rat, Rabbit samples.

• Tested Reactivity: Human, Pig, Mouse, Rat, Rabbit
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12563

  Product name: Recombinant human KCNA1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-163 aa of BC101733

  Sequence: MTVMSGENVDEASAAPGHPQDGSYPRQADHDDHECCERVVINISGLRFETQLKTLAQFPNTLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFYELGEEAMEKFREDEGFIKEEERPLPEKEYQRQVWLLFEYPESS

• Full Name: potassium voltage-gated channel, shaker-related subfamily, member 1 (episodic ataxia with myokymia)
• Calculated Molecular Weight: 495 aa, 56 kDa
• Observed Molecular Weight: 75 kDa
• GenBank Accession Number: BC101733
• Gene Symbol: KCNA1
• Gene ID (NCBI): 3736
• RRID: AB_2918755
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q09470
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.