KCNQ2 Monoclonal antibody

• 

  WB analysis using 66774-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66774-1-Ig (KCNQ2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 66774-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 66774-1-Ig (KCNQ2 antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 66774-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 66774-1-Ig (KCNQ2 antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of U2OS using 66774-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed U2OS cells using KCNQ2 antibody (66774-1-Ig, Clone: 1D4A1 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1).

KCNQ2 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66774-1-Ig

Clone No.1D4A1

Publications(3)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

1D4A1, BFNC, EBN, EBN1, ENB1

---

Tested Applications

• Positive WB detected in: pig brain tissue, rat brain tissue, mouse brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:300-1:1200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below
• IF: See 1 publications below

Product Information

66774-1-Ig targets KCNQ2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Cited Reactivity: mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25781

  Product name: Recombinant human KCNQ2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-81 aa of BC000699

  Sequence: MVQKSRNGGVYPGPSGEKKLKVGFVGLDPGAPDSTRDGALLIAGSEAPKRGSILSKPRAGGAGAGKPPKRNAFYRKLQNFL

• Full Name: potassium voltage-gated channel, KQT-like subfamily, member 2
• Calculated Molecular Weight: 96 kDa
• Observed Molecular Weight: 90 kDa
• GenBank Accession Number: BC000699
• Gene Symbol: KCNQ2
• Gene ID (NCBI): 3785
• RRID: AB_2882120
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O43526
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Sci Rep; Mir324 knockout regulates the structure of dendritic spines and impairs hippocampal long-term potentiation; Authors - Emma V Parkins
mouse	WB,IF	Hippocampus; Impacted spike frequency adaptation associated with reduction of KCNQ2/3 exacerbates seizure activity in temporal lobe epilepsy; Authors - Shicheng Jiang
rat	WB	Clin Exp Hypertens; Effect of allisartan on blood pressure and left ventricular hypertrophy through Kv1.5 channels in hypertensive rats.; Authors - Chunfang Xu