Product Information
66774-1-PBS targets KCNQ2 as part of a matched antibody pair:
MP50721-2: 66774-4-PBS capture and 66774-1-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
Tested Reactivity | human, mouse, rat, pig |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25781 Product name: Recombinant human KCNQ2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-81 aa of BC000699 Sequence: MVQKSRNGGVYPGPSGEKKLKVGFVGLDPGAPDSTRDGALLIAGSEAPKRGSILSKPRAGGAGAGKPPKRNAFYRKLQNFL Predict reactive species |
Full Name | potassium voltage-gated channel, KQT-like subfamily, member 2 |
Calculated Molecular Weight | 96 kDa |
Observed Molecular Weight | 90 kDa |
GenBank Accession Number | BC000699 |
Gene Symbol | KCNQ2 |
Gene ID (NCBI) | 3785 |
RRID | AB_2882120 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | O43526 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |