KCNQ2 Monoclonal antibody, PBS Only (Detector)

• 

  WB analysis using 66774-1-Ig (same clone as 66774-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66774-1-Ig (KCNQ2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66774-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 66774-1-Ig (same clone as 66774-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 66774-1-Ig (KCNQ2 antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66774-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 66774-1-Ig (same clone as 66774-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 66774-1-Ig (KCNQ2 antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66774-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 66774-1-Ig (same clone as 66774-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed U2OS cells using KCNQ2 antibody (66774-1-Ig, Clone: 1D4A1 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 66774-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP50721-2

  Cytometric bead array standard curve of MP50721-2, KCNQ2 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 66774-4-PBS. Detection antibody: 66774-1-PBS. Standard:Ag25781. Range: 0.781-100 ng/mL.

KCNQ2 Monoclonal Antibody for WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

Cat No. 66774-1-PBS

Clone No.1D4A1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

Synonyms

1D4A1, BFNC, EBN, EBN1, ENB1

---

Product Information

66774-1-PBS targets KCNQ2 as part of a matched antibody pair:

MP50721-2: 66774-4-PBS capture and 66774-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25781

  Product name: Recombinant human KCNQ2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-81 aa of BC000699

  Sequence: MVQKSRNGGVYPGPSGEKKLKVGFVGLDPGAPDSTRDGALLIAGSEAPKRGSILSKPRAGGAGAGKPPKRNAFYRKLQNFL

• Full Name: potassium voltage-gated channel, KQT-like subfamily, member 2
• Calculated Molecular Weight: 96 kDa
• Observed Molecular Weight: 90 kDa
• GenBank Accession Number: BC000699
• Gene Symbol: KCNQ2
• Gene ID (NCBI): 3785
• RRID: AB_2882120
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O43526
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.