Tested Applications
| Positive WB detected in | pig brain tissue, rat brain tissue, mouse brain tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | U2OS cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:300-1:1200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 4 publications below |
| IF | See 1 publications below |
Product Information
66774-1-Ig targets KCNQ2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25781 Product name: Recombinant human KCNQ2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-81 aa of BC000699 Sequence: MVQKSRNGGVYPGPSGEKKLKVGFVGLDPGAPDSTRDGALLIAGSEAPKRGSILSKPRAGGAGAGKPPKRNAFYRKLQNFL Predict reactive species |
| Full Name | potassium voltage-gated channel, KQT-like subfamily, member 2 |
| Calculated Molecular Weight | 96 kDa |
| Observed Molecular Weight | 90 kDa |
| GenBank Accession Number | BC000699 |
| Gene Symbol | KCNQ2 |
| Gene ID (NCBI) | 3785 |
| RRID | AB_2882120 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | O43526 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for KCNQ2 antibody 66774-1-Ig | Download protocol |
| IHC protocol for KCNQ2 antibody 66774-1-Ig | Download protocol |
| WB protocol for KCNQ2 antibody 66774-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Affect Disord Increased Kcnq2 in the hippocampal contributes to esketamine-induced long-term cognitive dysfunction in neonatal mice | ||
Sci Rep Mir324 knockout regulates the structure of dendritic spines and impairs hippocampal long-term potentiation | ||
Hippocampus Impacted spike frequency adaptation associated with reduction of KCNQ2/3 exacerbates seizure activity in temporal lobe epilepsy | ||
Clin Exp Hypertens Effect of allisartan on blood pressure and left ventricular hypertrophy through Kv1.5 channels in hypertensive rats. | ||
Curr Eye Res Transcriptome Sequencing Reveals ceRNA Networks and Molecular Signatures in Myopic Mouse Retina |







